DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5948 and SOD1

DIOPT Version :9

Sequence 1:NP_651440.1 Gene:CG5948 / 43133 FlyBaseID:FBgn0039386 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_000445.1 Gene:SOD1 / 6647 HGNCID:11179 Length:154 Species:Homo sapiens


Alignment Length:162 Identity:52/162 - (32%)
Similarity:71/162 - (43%) Gaps:33/162 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 LMGDGEGAGVAGMISFVQLPYNSDIRVTINVTGLPPGKHALHIHTFGDLSDGCKSTGGQF----- 158
            |.|||.   |.|:|:|.|...|..::|..::.||..|.|..|:|.|||.:.||.|.|..|     
Human     9 LKGDGP---VQGIINFEQKESNGPVKVWGSIKGLTEGLHGFHVHEFGDNTAGCTSAGPHFNPLSR 70

  Fly   159 ----PNN------FLGNVDTKDDGSISAVFQSIYLQLFGINGIVGRSIVIHSKAIDLNTALNAEV 213
                |.:      .||||....||......:...:.|.|.:.|:||::|:|.||.||....|.| 
Human    71 KHGGPKDEERHVGDLGNVTADKDGVADVSIEDSVISLSGDHCIIGRTLVVHEKADDLGKGGNEE- 134

  Fly   214 FSSSLQAMPNPLAYQNEENSLGPAIACGVISI 245
                          ..:..:.|..:|||||.|
Human   135 --------------STKTGNAGSRLACGVIGI 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5948NP_651440.1 Sod_Cu 108..243 CDD:278508 45/149 (30%)
SOD1NP_000445.1 Cu-Zn_Superoxide_Dismutase 3..147 CDD:238186 46/155 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1574423at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10003
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.