DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5948 and Ccs

DIOPT Version :9

Sequence 1:NP_651440.1 Gene:CG5948 / 43133 FlyBaseID:FBgn0039386 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001163108.1 Gene:Ccs / 46035 FlyBaseID:FBgn0010531 Length:264 Species:Drosophila melanogaster


Alignment Length:167 Identity:45/167 - (26%)
Similarity:71/167 - (42%) Gaps:43/167 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 VAGMISFVQLPYNSDIRVTIN--VTGLPPGKHALHIHTFGDLSDGCKSTG-----GQFPNNF--- 162
            :.|::.|..:..:....|.::  |.||.||.|.||||..||.|.||.|.|     .|.|:..   
  Fly    90 IQGVVRFTTITADKKPGVVVDGVVDGLSPGLHGLHIHESGDTSAGCSSVGEHYNPRQSPHGSPAA 154

  Fly   163 ---------LGNVDTKDDGSISAVFQSIYLQLFGINGIVGRSIVIHSKAIDLNTALNAEVFSSSL 218
                     |||:...::|..:..|....|:::   .|:||::|:.:.|.||....|.:...   
  Fly   155 GAEERHAGDLGNIRADENGRATFRFVDPVLEVW---DIIGRAVVLTANADDLGRGGNDQSLI--- 213

  Fly   219 QAMPNPLAYQNEENSLGPAIACGVISIMSTAASSSGM 255
                        :.:.|..||||:|      |.|:|:
  Fly   214 ------------DGNSGERIACGII------ARSAGI 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5948NP_651440.1 Sod_Cu 108..243 CDD:278508 41/153 (27%)
CcsNP_001163108.1 PLN02957 1..253 CDD:215516 45/167 (27%)
HMA 5..64 CDD:238219
Cu-Zn_Superoxide_Dismutase 72..223 CDD:238186 38/150 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10003
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.