DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5948 and Sod1

DIOPT Version :9

Sequence 1:NP_651440.1 Gene:CG5948 / 43133 FlyBaseID:FBgn0039386 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_476735.1 Gene:Sod1 / 39251 FlyBaseID:FBgn0003462 Length:153 Species:Drosophila melanogaster


Alignment Length:161 Identity:46/161 - (28%)
Similarity:69/161 - (42%) Gaps:37/161 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 GDGEGAGVAGMISFVQLPYNSDIRVTINVTGLPPGKHALHIHTFGDLSDGCKSTGGQFPNNF--- 162
            ||.:|.     :.|.|....:.::|:..|.||..|.|..|:|.|||.::||.|:|..| |.:   
  Fly    11 GDAKGT-----VFFEQESSGTPVKVSGEVCGLAKGLHGFHVHEFGDNTNGCMSSGPHF-NPYGKE 69

  Fly   163 -------------LGNVDTKDDGSISAVFQSIYLQLFGINGIVGRSIVIHSKAIDLNTALNAEVF 214
                         |||::...|...........:.|||.:.|:||::|:|:.|.||... ..|:.
  Fly    70 HGAPVDENRHLGDLGNIEATGDCPTKVNITDSKITLFGADSIIGRTVVVHADADDLGQG-GHELS 133

  Fly   215 SSSLQAMPNPLAYQNEENSLGPAIACGVISI 245
            .|:              .:.|..|.||||.|
  Fly   134 KST--------------GNAGARIGCGVIGI 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5948NP_651440.1 Sod_Cu 108..243 CDD:278508 40/150 (27%)
Sod1NP_476735.1 Cu-Zn_Superoxide_Dismutase 2..150 CDD:412632 45/159 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S341
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1574423at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10003
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.970

Return to query results.
Submit another query.