DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5948 and Sod3

DIOPT Version :9

Sequence 1:NP_651440.1 Gene:CG5948 / 43133 FlyBaseID:FBgn0039386 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001033939.2 Gene:Sod3 / 36232 FlyBaseID:FBgn0033631 Length:243 Species:Drosophila melanogaster


Alignment Length:187 Identity:55/187 - (29%)
Similarity:80/187 - (42%) Gaps:39/187 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 QAGAKLMG--DGEGAGVAGMISFVQLPYNSDIRVTINVTGLPPGKHALHIHTFGDLSDGCKSTGG 156
            ||.|.|:|  ..:...|.|.::|.|.....::.|.:.:.||..|||..|||..|||::||.|.|.
  Fly    27 QAIAYLIGPVQSDNTQVKGNVTFTQNDCGQNVHVRVQLEGLKEGKHGFHIHEKGDLTNGCISMGA 91

  Fly   157 QF-PNNF--------------LGNVDTKDDGSISAVFQSIYLQLFGINGIVGRSIVIHSKAIDLN 206
            .: |:..              |||::....|.|...:....:.|.|..||:||.:|:|....||.
  Fly    92 HYNPDKVDHGGPDHEVRHVGDLGNLEANSTGIIDVTYTDQVITLTGKLGIIGRGVVVHELEDDLG 156

  Fly   207 TALNAEVFSSSLQAMPNPLAYQNEENSLGPAIACGVISIMSTAASSSGMATAAPAPP 263
            ...:.:               ..:..:.|..||||||.|       :|.:..|||||
  Fly   157 LGNHTD---------------SKKTGNAGGRIACGVIGI-------NGPSVPAPAPP 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5948NP_651440.1 Sod_Cu 108..243 CDD:278508 41/149 (28%)
Sod3NP_001033939.2 Sod_Cu 42..178 CDD:278508 41/150 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2032
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S341
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1574423at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10003
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.870

Return to query results.
Submit another query.