DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5948 and ccs1

DIOPT Version :9

Sequence 1:NP_651440.1 Gene:CG5948 / 43133 FlyBaseID:FBgn0039386 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001342818.1 Gene:ccs1 / 2541803 PomBaseID:SPAC22E12.04 Length:297 Species:Schizosaccharomyces pombe


Alignment Length:138 Identity:34/138 - (24%)
Similarity:52/138 - (37%) Gaps:36/138 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 VSGTKVKRYERLTVPLGGPVGIPGAAGLLGPLLPPQPSYLGYTYQL------VPQWQAGAKLMGD 102
            ||.:||.|  ||......|:.|.||:.        :.|.:...|:.      :|:          
pombe    46 VSPSKVLR--RLENATSKPILIRGASN--------KESGVSILYEANEDITQIPK---------- 90

  Fly   103 GEGAGVAGMISFVQLPYNSDIRVTINVTGLPPGKHALHIHTF-GDLSDGCKSTGGQFPNNFLGNV 166
                 |.|:..|:  |....|.:.:..|.|.|.:....:.|. ||:|.|.||.|......|  |.
pombe    91 -----VYGLCRFI--PTEEKIFLDLIATQLLPNREYTGLVTISGDISRGLKSAGDSLVTLF--NA 146

  Fly   167 DTKDDGSI 174
            ::.:.|.|
pombe   147 NSNEQGKI 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5948NP_651440.1 Sod_Cu 108..243 CDD:278508 20/68 (29%)
ccs1NP_001342818.1 Cu-Zn_Superoxide_Dismutase <89..210 CDD:321233 21/85 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.