DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5948 and Sod3

DIOPT Version :9

Sequence 1:NP_651440.1 Gene:CG5948 / 43133 FlyBaseID:FBgn0039386 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_035565.1 Gene:Sod3 / 20657 MGIID:103181 Length:251 Species:Mus musculus


Alignment Length:283 Identity:75/283 - (26%)
Similarity:109/283 - (38%) Gaps:79/283 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLIKLILALVIGYGG---IFAPG-SAQNLLDRLRPVNMTRFDDGIKVVSGTKVKRYERLTVPLGG 61
            ||..|...|::...|   :..|| |:.:|.|||.||......|.::.:..|..|..| :.:.||.
Mouse     1 MLAFLFYGLLLAACGSVTMSNPGESSFDLADRLDPVEKIDRLDLVEKIGDTHAKVLE-IWMELGR 64

  Fly    62 PVGI------------PGAAGLLGPLLPPQPSYLGYTYQLVPQWQAGAKLMGDGEGAGVAGMISF 114
            ...:            |.|.      |||..          ||               :.|::.|
Mouse    65 RREVDAAEMHAICRVQPSAT------LPPDQ----------PQ---------------ITGLVLF 98

  Fly   115 VQLPYNSDIRVTINVTGLP----PGKHALHIHTFGDLSDGCKSTG----------GQFPNNFLGN 165
            .||...|.:....::.|.|    ....|:|:|.|||||.||.|||          .|.|.:| ||
Mouse    99 RQLGPGSRLEAYFSLEGFPAEQNASNRAIHVHEFGDLSQGCDSTGPHYNPMEVPHPQHPGDF-GN 162

  Fly   166 VDTKDDGSISAVFQSIYLQLFGINGIVGRSIVIHSKAIDLNTALNAEVFSSSLQAMPNPLAYQNE 230
            ...: :|.:......:...|.|.:.|:|||:|:|:...||....|    .:|||           
Mouse   163 FVVR-NGQLWRHRVGLTASLAGPHAILGRSVVVHAGEDDLGKGGN----QASLQ----------- 211

  Fly   231 ENSLGPAIACGVISIMSTAASSS 253
            ..:.|..:||.|:...|:||..|
Mouse   212 NGNAGRRLACCVVGTSSSAAWES 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5948NP_651440.1 Sod_Cu 108..243 CDD:278508 43/148 (29%)
Sod3NP_035565.1 Sod_Cu 91..224 CDD:278508 44/164 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 230..251 3/5 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10003
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.870

Return to query results.
Submit another query.