DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5948 and sod-5

DIOPT Version :9

Sequence 1:NP_651440.1 Gene:CG5948 / 43133 FlyBaseID:FBgn0039386 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_494779.1 Gene:sod-5 / 173776 WormBaseID:WBGene00007036 Length:178 Species:Caenorhabditis elegans


Alignment Length:172 Identity:52/172 - (30%)
Similarity:68/172 - (39%) Gaps:39/172 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 GAGVAGMISFVQLPYNSDIRVTINVTGLPPGKHALHIHTFGDLSDGCKSTGGQF-PNNF------ 162
            |..|.|.:...|.....:......:.||.||.|..|||.:||.:|||.|.|..| |...      
 Worm    31 GTAVFGTVWLTQKAEGEETEFEGEIKGLSPGLHGFHIHQYGDSTDGCTSAGPHFNPCKMNHGGRD 95

  Fly   163 --------LGNVDTKDDGSISAVFQSIYLQLFGINGIVGRSIVIHSKAIDLNTALNAEVFSSSLQ 219
                    ||||:...||.....|....:.|||.|.::|||:|:|....||...::.:. ..||:
 Worm    96 SVVRHVGDLGNVEAGADGVAKIKFSDKVVSLFGANTVIGRSMVVHVDRDDLGQGIDDKA-EESLK 159

  Fly   220 AMPNPLAYQNEENSLGPAIACGVISIMSTAASSSGMATAAPA 261
            .           .:.|...|||||            |.||||
 Worm   160 T-----------GNAGARAACGVI------------ALAAPA 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5948NP_651440.1 Sod_Cu 108..243 CDD:278508 44/149 (30%)
sod-5NP_494779.1 Sod_Cu 33..172 CDD:278508 44/150 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S341
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1574423at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10003
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.870

Return to query results.
Submit another query.