DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5913 and FAM98C

DIOPT Version :9

Sequence 1:NP_651439.2 Gene:CG5913 / 43132 FlyBaseID:FBgn0039385 Length:454 Species:Drosophila melanogaster
Sequence 2:NP_777565.3 Gene:FAM98C / 147965 HGNCID:27119 Length:349 Species:Homo sapiens


Alignment Length:359 Identity:100/359 - (27%)
Similarity:167/359 - (46%) Gaps:53/359 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 VDSLKALSFQGHCQKQENLS-------RALDAGIESPDMQEVVLWLAHELHILRKTDER------ 60
            ::::||.:::|....|:.|:       .|...|...||.:.:.:.||.||..|...:::      
Human     1 MEAVKAEAWEGAAVAQDLLALGYGGVPGAASRGASCPDFRGLCVRLAAELATLGALEQQREAGAE 65

  Fly    61 ---VNQGKALNKDFSFELSLLLTELGCPYRELVQGPIEQRFKSRMALVQLLEYLTSELMTTKMVL 122
               ...|....:||..:|..||.||.||.|.|..|......:...|.::||.:|.|||..|::: 
Human    66 VLSAGDGPGAEEDFLRQLGSLLRELHCPDRALCGGDGAAALREPGAGLRLLRFLCSELQATRLL- 129

  Fly   123 KAQPVGPPCKRSKVDTNVQQ-----------VVENLAKDLQLGEVPK---NINTKMLFEKITPRL 173
                    |.||.:|.:.:.           :|:.|...||...:|:   ......|.:::..::
Human   130 --------CLRSLLDPSPRPPLGEGVVEGAGMVQELDLTLQALGLPRPAPGTPASQLLQELHAKI 186

  Fly   174 EQAIKKTNPQVLSEPLLKLKKPLTDAQWQLLETLHRELEAEYNLRRQMMSTRLEATVQSFQWSES 238
            .: ::.:.|....:|||...  |...:|:.||:|.:.|..:|..||.::..||:.|..:|.||: 
Human   187 SE-LQPSLPPGSLQPLLSCS--LDAPRWEALESLSQSLRDQYRCRRCLLLKRLDLTTSAFHWSD- 247

  Fly   239 MRQRSNEIMDRFNRKMRELDQFKVGGKQTD--LVALLAARSDLAIIEKTSSANVRKNTASKIQKH 301
            ..:...|.|......:||     |...::|  :..:||||:||:.:...:|..||:.|...|.|.
Human   248 RAEAQGEAMRAVLIPIRE-----VLTPESDISIAHVLAARADLSCLVPATSVAVRRGTCCAINKV 307

  Fly   302 VIGRVPDRGGRANEHAPPPPEMPSWQQQRASGPP 335
            ::|.|||||||.||..||   ||:|:.:|..|.|
Human   308 LMGNVPDRGGRPNELEPP---MPTWRSRREDGGP 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5913NP_651439.2 DUF2465 9..328 CDD:287241 97/350 (28%)
FAM98CNP_777565.3 DUF2465 18..334 CDD:287241 93/336 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 313..349 16/29 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165159535
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3973
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D346789at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR31353
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
76.810

Return to query results.
Submit another query.