DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lnk and FES

DIOPT Version :9

Sequence 1:NP_001287536.1 Gene:Lnk / 43130 FlyBaseID:FBgn0028717 Length:728 Species:Drosophila melanogaster
Sequence 2:NP_001996.1 Gene:FES / 2242 HGNCID:3657 Length:822 Species:Homo sapiens


Alignment Length:626 Identity:129/626 - (20%)
Similarity:210/626 - (33%) Gaps:191/626 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 EEFCERHA----------RVAASDFAKACITYINGNLPPEEARNIQHRSFAQ-KFVES---FSAH 119
            :|..:.|:          |..|.|.|:|...|       :||...:.|..|: |:|.|   ..||
Human   125 QELTKTHSQDIEKLKSQYRALARDSAQAKRKY-------QEASKDKDRDKAKDKYVRSLWKLFAH 182

  Fly   120 YDTEFFKRRSTLKSGAGSLDFEEEHEVPKLLSKSLLRRLSFKGLRKGKI----SLLQAFFHKNSD 180
            ::      |..|...|..|..:..|:   ||...|||  |.:.|.:...    .:||.:...:|.
Human   183 HN------RYVLGVRAAQLHHQHHHQ---LLLPGLLR--SLQDLHEEMACILKEILQEYLEISSL 236

  Fly   181 DLDGSGGSGKQSKTKLAKIVVEC------RKEGTVNNLTP-----ESLDQPTGSQKWEKCRLVLV 234
            ..|......::.....|:|..|.      |:.|:..::.|     |||                 
Human   237 VQDEVVAIHREMAAAAARIQPEAEYQGFLRQYGSAPDVPPCVTFDESL----------------- 284

  Fly   235 KAVGGYMLEFYTPHKATKPRSGVFCFLISEARETTALEMPDRLNTFVLKADNNMEYVIEAESAEE 299
                   ||...|   .:|.......|..|:.:.|...:.|.|...........|.|.:.:  :|
Human   285 -------LEEGEP---LEPGELQLNELTVESVQHTLTSVTDELAVATEMVFRRQEMVTQLQ--QE 337

  Fly   300 MRSWLATIRYCMRTPPTQQPTIESDGVMASAMQTSPTLPSPNPIGGIQ-------NPQYQQQ-RG 356
            :|:......     |..:...:....|:..|:|            |:|       ..|.||: ..
Human   338 LRNEEENTH-----PRERVQLLGKRQVLQEALQ------------GLQVALCSQAKLQAQQELLQ 385

  Fly   357 SNGNLVGGGAPLTSSLSADSALGQGGATSASELNVINELGTSPT--------SG--------PPD 405
            :....:|.|.|....|..|..    .:||:||..  .|.|.:||        ||        ||.
Human   386 TKLEHLGPGEPPPVLLLQDDR----HSTSSSEQE--REGGRTPTLEILKSHISGIFRPKFSLPPP 444

  Fly   406 IPVRPHRGEQRLSASSNFDGIEGTENDADVADLTAEMSVFPWFHGTLTRSEAARMVLHSDAAGHG 470
            :.:.|                          ::...:....|:||.:.|:|.|.:::||     |
Human   445 LQLIP--------------------------EVQKPLHEQLWYHGAIPRAEVAELLVHS-----G 478

  Fly   471 YFLVRQSETRRGEFVLTFNFQGRAKHLRLTISEKGQCRVQHLWFPSIQEMLEHF--RHNPIPLES 533
            .||||:|:.:: |:||:..:.|..:|. :..|.....|::...||||..:::|.  ...|:..:|
Human   479 DFLVRESQGKQ-EYVLSVLWDGLPRHF-IIQSLDNLYRLEGEGFPSIPLLIDHLLSTQQPLTKKS 541

  Fly   534 GGT--SDVTLTEWVHSHSRLNDPTTAANHDSGQLNDLSTNGNGNGNGNGYDNGQGSSTASNAAGG 596
            |..  ..|...:||.:|..|                  ..|...|.||..:...|...|.|....
Human   542 GVVLHRAVPKDKWVLNHEDL------------------VLGEQIGRGNFGEVFSGRLRADNTLVA 588

  Fly   597 TASGAAGGGHPSPRHCNEVITMNLSVRLKTNEIELPQEPTH 637
            ..|            |.|.:..:|..:. ..|..:.::.:|
Human   589 VKS------------CRETLPPDLKAKF-LQEARILKQYSH 616

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LnkNP_001287536.1 Phe_ZIP 67..125 CDD:286060 17/69 (25%)
PH_SH2B_family 202..313 CDD:269938 20/121 (17%)
PH 220..312 CDD:278594 13/91 (14%)
SH2_SH2B_family 438..534 CDD:198209 27/97 (28%)
FESNP_001996.1 Important for interaction with membranes containing phosphoinositides 1..300 46/219 (21%)
F-BAR_Fes 7..239 CDD:153369 32/131 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 394..421 10/32 (31%)
SH2_Fps_family 453..537 CDD:198224 26/90 (29%)
Pkinase_Tyr 561..814 CDD:285015 14/87 (16%)
PTKc_Fes 564..815 CDD:270667 13/66 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.