DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SppL and SPPL2A

DIOPT Version :9

Sequence 1:NP_001163740.1 Gene:SppL / 43128 FlyBaseID:FBgn0039381 Length:422 Species:Drosophila melanogaster
Sequence 2:XP_005254779.1 Gene:SPPL2A / 84888 HGNCID:30227 Length:538 Species:Homo sapiens


Alignment Length:423 Identity:101/423 - (23%)
Similarity:187/423 - (44%) Gaps:104/423 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 EYRELHWTVSSVM------------DSSRVSTCLISMLLIVYGSFRSLNIEQE------AREREQ 77
            ::|:::.|:...:            |.:.|...:|::..:..|.:.|..:|.|      ..:||.
Human   144 DFRDMNQTLGDNITVKMYSPSWPNFDYTMVVIFVIAVFTVALGGYWSGLVELENLKAVTTEDREM 208

  Fly    78 KKRNESMTNLLTGEPVEKEPNLYFTADKFATLDTMHALCLPLGASISLLIMFFFFD----SMQLL 138
            :|:.|   ..||..|:              |:.....:|     .:.:::::||:.    .|..:
Human   209 RKKKE---EYLTFSPL--------------TVVIFVVIC-----CVMMVLLYFFYKWLVYVMIAI 251

  Fly   139 FAVCTAIIATVALAFLL--LPMCQYIIRPCT---DGKRFSFGFCGRFTAAELFSFTLSVSIVCIW 198
            |.:.:|:.....||.|:  :|..|     ||   .||......        :|...|.:::..:|
Human   252 FCIASAMSLYNCLAALIHKIPYGQ-----CTIACRGKNMEVRL--------IFLSGLCIAVAVVW 303

  Fly   199 VLTGH-----WLLMDAMGMGLCVAFIAFVRLPSLKVSTLLLTGLLIYDVFWVFLSSYIFST--NV 256
            .:..:     |:|.|.:|:..|:..|..::||:.|...:||..||:||||:||::.:|...  ::
Human   304 AVFRNEDRWAWILQDILGIAFCLNLIKTLKLPNFKSCVILLGLLLLYDVFFVFITPFITKNGESI 368

  Fly   257 MVKVATRPADNPVGIVARKLHLGGIVRDT-----PKLNLP-----GKLVFPSLHNT--GHFSMLG 309
            ||::|..|..|      .:.:.|.:|..|     |...||     .||::.|:.:.  ...|:||
Human   369 MVELAAGPFGN------NEKNDGNLVEATGQPSAPHEKLPVVIRVPKLIYFSVMSVCLMPVSILG 427

  Fly   310 LGDVVMPGLLLCFVLRYDAYKKAQGVTSDPTLSPPRGVGSRLTYFHCSLLGYFLGLLTATVSSEV 374
            .||:::||||:.:..|:|..                 .||...|:..|.:.|.:|::...|...:
Human   428 FGDIIVPGLLIAYCRRFDVQ-----------------TGSSYIYYVSSTVAYAIGMILTFVVLVL 475

  Fly   375 FKAAQPALLYLVPFTLLPLLLMAYLKGDLRRMW 407
            .|..|||||||||.||:...::|:.:.::::.|
Human   476 MKKGQPALLYLVPCTLITASVVAWRRKEMKKFW 508

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SppLNP_001163740.1 Peptidase_A22B 102..413 CDD:282158 85/334 (25%)
SPPL2AXP_005254779.1 PA_hSPPL_like 41..160 CDD:239044 2/15 (13%)
Peptidase_A22B 210..514 CDD:282158 90/357 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2443
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.