DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SppL and SPPL2

DIOPT Version :9

Sequence 1:NP_001163740.1 Gene:SppL / 43128 FlyBaseID:FBgn0039381 Length:422 Species:Drosophila melanogaster
Sequence 2:NP_564815.1 Gene:SPPL2 / 842673 AraportID:AT1G63690 Length:540 Species:Arabidopsis thaliana


Alignment Length:391 Identity:108/391 - (27%)
Similarity:175/391 - (44%) Gaps:81/391 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 MDSSRVSTCLISMLLIVYGSFRSLNIEQEAREREQKKRNESMTNLLTGEPVEKEPNLYFTADKFA 107
            :|.:.|...|:::..|:..|:.|....:||.....|         |..:.:::.||.........
plant   192 VDVAEVFLWLMAIGTILCASYWSAWSAREAAIEHDK---------LLKDAIDEIPNTNDGGSGVV 247

  Fly   108 TLDTMHALCLPLGASISLLIM-----FFFFDSMQLLFAVCTAIIATVALAFLLLPMCQ-----YI 162
            .::::.|:...:.||..|:|:     ::|.:.:.::|.:.........|..||....|     |:
plant   248 EINSISAIFFVVLASGFLVILYKLMSYWFVELLVVVFCIGGVEGLQTCLVALLSRWFQRAADTYV 312

  Fly   163 IRPCTDGKRFSFGFCGRFTAAELFSFTLSVSIVCI-----W-VLTGH---WLLMDAMGMGLCVAF 218
            ..|          |.|     .:...||:||..||     | |...|   |:..|.:|:.|.:..
plant   313 KVP----------FLG-----PISYLTLAVSPFCIVFAVLWAVYRVHSFAWIGQDVLGIALIITV 362

  Fly   219 IAFVRLPSLKVSTLLLTGLLIYDVFWVFLSSYIFSTNVMVKVATRPADNPVGIVARKLHLGGIVR 283
            :..|.:|:|||.|:||:...:||:||||:|..:|..:||:.||........||            
plant   363 LQIVHVPNLKVGTVLLSCAFLYDIFWVFVSKKLFHESVMIVVARGDKSGEDGI------------ 415

  Fly   284 DTPKLNLPGKLVFPSLHNT-GHFSMLGLGDVVMPGLLLCFVLRYDAYKKAQGVTSDPTLSPPRGV 347
                   |..|..|.:.:. |.:|::|.||:::||||:.|.||||       ..::.||      
plant   416 -------PMLLKIPRMFDPWGGYSIIGFGDILLPGLLIAFALRYD-------WLANKTL------ 460

  Fly   348 GSRLTYFHCSLLGYFLGLLTATVSSEVFKA-AQPALLYLVPFTLLPLLLMAYLKGDLRRMWS--E 409
              |..||..:::.|.||||...|:..:... .||||||:|||||..:|.:|..:.||..:|:  |
plant   461 --RTGYFIWAMVAYGLGLLITYVALNLMDGHGQPALLYIVPFTLGTMLTLARKRDDLWILWTKGE 523

  Fly   410 P 410
            |
plant   524 P 524

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SppLNP_001163740.1 Peptidase_A22B 102..413 CDD:282158 96/332 (29%)
SPPL2NP_564815.1 PA_GO-like 46..184 CDD:239047
Peptidase_A22B 245..525 CDD:282158 96/329 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2443
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.