DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SppL and SPP

DIOPT Version :9

Sequence 1:NP_001163740.1 Gene:SppL / 43128 FlyBaseID:FBgn0039381 Length:422 Species:Drosophila melanogaster
Sequence 2:NP_565294.1 Gene:SPP / 814841 AraportID:AT2G03120 Length:344 Species:Arabidopsis thaliana


Alignment Length:383 Identity:118/383 - (30%)
Similarity:165/383 - (43%) Gaps:98/383 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 KRNESMTNL----LTGEP--VEKEPNLYFTADKFATL--------------DTM---HALCLPLG 120
            |..|...||    ||..|  |...|||........|:              :||   ||:..||.
plant     2 KNCERFANLALAGLTLAPLVVRVNPNLNVILTACITVYVGCFRSVKDTPPTETMSKEHAMRFPLV 66

  Fly   121 ASISLLIMF--FFFDSMQLLFAVCTA---IIATVALAFLLLP-MCQYIIRPCTDGK---RFSFGF 176
            .|..||.:|  |.|.|..|:.||.||   ::..|||:..||| :.:::..|..|..   ||.:  
plant    67 GSAMLLSLFLLFKFLSKDLVNAVLTAYFFVLGIVALSATLLPAIRRFLPNPWNDNLIVWRFPY-- 129

  Fly   177 CGRFTAAELFSFTLSVSIV-------CIW-VLTGHWLLMDAMGMGLCVAFIAFVRLPSLKVSTLL 233
               |.:.|: .||.|..:.       |.| ....|||..:.:|:..|:..|..:.|.|.|...:|
plant   130 ---FKSLEV-EFTKSQVVAGIPGTFFCAWYAWKKHWLANNILGLSFCIQGIEMLSLGSFKTGAIL 190

  Fly   234 LTGLLIYDVFWVFLSSYIFSTNVMVKVATRPADNPVGIVARKLHLGGIVRDTPKLNLPGKLVFPS 298
            |.||..||:||||.      |.|||.|| :..|.|:                       ||:||:
plant   191 LAGLFFYDIFWVFF------TPVMVSVA-KSFDAPI-----------------------KLLFPT 225

  Fly   299 LHNTGHFSMLGLGDVVMPGLLLCFVLRYDAYKKAQGVTSDPTLSPPRGVGSRLTYFHCSLLGYFL 363
            ......:|||||||:|:||:.:...||:|..::.|          |:       ||..:.:||.:
plant   226 GDALRPYSMLGLGDIVIPGIFVALALRFDVSRRRQ----------PQ-------YFTSAFIGYAV 273

  Fly   364 GLLTATVSSEVFKAAQPALLYLVPFTLLPLLLMAYLKGDLRRMWSEPFIAQQPSKQLE 421
            |::...|....|:||||||||:||..:..|.......||::     |.:|...||..|
plant   274 GVILTIVVMNWFQAAQPALLYIVPAVIGFLASHCIWNGDIK-----PLLAFDESKTEE 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SppLNP_001163740.1 Peptidase_A22B 102..413 CDD:282158 103/344 (30%)
SPPNP_565294.1 Peptidase_A22B 47..323 CDD:282158 103/333 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2443
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1087991at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.