DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SppL and SPPL2B

DIOPT Version :9

Sequence 1:NP_001163740.1 Gene:SppL / 43128 FlyBaseID:FBgn0039381 Length:422 Species:Drosophila melanogaster
Sequence 2:XP_011526440.1 Gene:SPPL2B / 56928 HGNCID:30627 Length:618 Species:Homo sapiens


Alignment Length:312 Identity:88/312 - (28%)
Similarity:142/312 - (45%) Gaps:76/312 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   125 LLIMFFFFDSMQLLFAVCTAIIATVALAFLLLPMCQYIIRPCTDGKRFSFGFC------------ 177
            |:::::|:|   ||..|...|....:...|.  .|   :.||.  :|..||.|            
Human   263 LVLLYYFYD---LLVYVVIGIFCLASATGLY--SC---LAPCV--RRLPFGKCRIPNNSLPYFHK 317

  Fly   178 ---GRFTAAELFSFTLSVSIVCIWVLTGH-----WLLMDAMGMGLCVAFIAFVRLPSLKVSTLLL 234
               .|.....||...:||    :|.:..:     |:|.||:|:..|:..:..:|||:.|..||||
Human   318 RPQARMLLLALFCVAVSV----VWGVFRNEDQWAWVLQDALGIAFCLYMLKTIRLPTFKACTLLL 378

  Fly   235 TGLLIYDVFWVFLSSYI--FSTNVMVKVATRPADNPVGIVARKLHLGGIVRDTPKLNLPGKLVFP 297
            ..|.:||:|:||::.::  ..:::||:|||.|:|:                 ..:..||..|..|
Human   379 LVLFLYDIFFVFITPFLTKSGSSIMVEVATGPSDS-----------------ATREKLPMVLKVP 426

  Fly   298 SLHNT------GHFSMLGLGDVVMPGLLLCFVLRYDAYKKAQGVTSDPTLSPPRGVGSRLTYFHC 356
            .|:::      ..||:||.||:::||||:.:..|:|..                 |.|...||..
Human   427 RLNSSPLALCDRPFSLLGFGDILVPGLLVAYCHRFDIQ-----------------VQSSRVYFVA 474

  Fly   357 SLLGYFLGLLTATVSSEVFKAAQPALLYLVPFTLLPLLLMAYLKGDLRRMWS 408
            ..:.|.:|||...|:..:.:..|||||||||.||:....:|..:.:|...|:
Human   475 CTIAYGVGLLVTFVALALMQRGQPALLYLVPCTLVTSCAVALWRRELGVFWT 526

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SppLNP_001163740.1 Peptidase_A22B 102..413 CDD:282158 88/312 (28%)
SPPL2BXP_011526440.1 PA_hSPPL_like 71..190 CDD:239044
Peptidase_A22B 239..531 CDD:282158 88/312 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2443
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.