DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SppL and Sppl2a

DIOPT Version :9

Sequence 1:NP_001163740.1 Gene:SppL / 43128 FlyBaseID:FBgn0039381 Length:422 Species:Drosophila melanogaster
Sequence 2:XP_006234982.1 Gene:Sppl2a / 311401 RGDID:1563001 Length:541 Species:Rattus norvegicus


Alignment Length:396 Identity:99/396 - (25%)
Similarity:176/396 - (44%) Gaps:88/396 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 DSSRVSTCLISMLLIVYGSF-------RSLNIEQEAREREQKKRNESMTNLLTGEPVEKEPNLYF 101
            |.:.|...:|::..:..|.:       .|:...::|.:||.:|:.|   :.||..|:        
  Rat   172 DYTLVVIFVIAVFTVALGGYWSGLIELESMKAVEDAEDREARKKKE---DYLTFSPL-------- 225

  Fly   102 TADKFATLDTMHALCLPLGASISLLIMFFFFD----SMQLLFAVCTAIIATVALAFLL--LPMCQ 160
                  |:.....:|     .:.:::::||:.    .|..:|.:.:|......||.|:  :|..|
  Rat   226 ------TVVLFVVIC-----CVMIVLLYFFYKWLVYVMIAIFCIASATSLYNCLAALIHRMPCGQ 279

  Fly   161 YIIRPCTDGKRFSFGFCGRFTAAELFSFTLSVSIVCIWVLTGH-----WLLMDAMGMGLCVAFIA 220
            ..|..|  ||......        :|...|.:|:..:|.:..:     |:|.|.:|:..|:..|.
  Rat   280 CTILCC--GKNIKVSL--------IFLSGLCISVAVVWAVFRNEDRWAWILQDILGIAFCLNLIK 334

  Fly   221 FVRLPSLKVSTLLLTGLLIYDVFWVFLSSYIFST--NVMVKVATRPADNPVG-----IVARKLHL 278
            .::||:.....:||..|||||||:||::.:|...  ::||::|..|.:|...     :.|..|| 
  Rat   335 TMKLPNFMSCVILLGLLLIYDVFFVFITPFITKNGESIMVELAAGPFENAEKNDGNFVEATALH- 398

  Fly   279 GGIVRDTPKLNLPGKLVFPSLHN-------TGHFSMLGLGDVVMPGLLLCFVLRYDAYKKAQGVT 336
                 ..|...||..:..|.|.:       :...|:||.||:::||||:.:..|:|..       
  Rat   399 -----SAPHEKLPVVIRVPKLMDYSVMSVCSVPVSVLGFGDIIVPGLLIAYCRRFDVQ------- 451

  Fly   337 SDPTLSPPRGVGSRLTYFHCSLLGYFLGLLTATVSSEVFKAAQPALLYLVPFTLLPLLLMAYLKG 401
                      .||.: |:..|.:.|.:|::...|...|.|..|||||||||.||:...::|:.:.
  Rat   452 ----------TGSSI-YYISSTIAYAVGMIITFVVLMVMKTGQPALLYLVPCTLITASIVAWSRK 505

  Fly   402 DLRRMW 407
            ::::.|
  Rat   506 EMKKFW 511

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SppLNP_001163740.1 Peptidase_A22B 102..413 CDD:282158 86/331 (26%)
Sppl2aXP_006234982.1 Peptidases_S8_S53 44..163 CDD:299169
Peptidase_A22B 214..517 CDD:282158 91/354 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2443
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.