DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SppL and Sppl2c

DIOPT Version :9

Sequence 1:NP_001163740.1 Gene:SppL / 43128 FlyBaseID:FBgn0039381 Length:422 Species:Drosophila melanogaster
Sequence 2:NP_950184.2 Gene:Sppl2c / 237958 MGIID:3045264 Length:690 Species:Mus musculus


Alignment Length:429 Identity:109/429 - (25%)
Similarity:179/429 - (41%) Gaps:111/429 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 LGGGAAAAGGGEYRELHWTVSSVMDSSRVSTCLISMLLIVYGSFRSLNIEQE-AREREQKKRNES 83
            |..|..||||      :|  :.:|:::::.......    .|.....|.:|. |.||.|:...: 
Mouse   199 LAVGTVAAGG------YW--AGLMEANKLQRRQAQR----GGGLGGHNQQQTVAAERSQRAWED- 250

  Fly    84 MTNLLTGEPVEKEPNLYFTADKFATLDTMHALCLPLGASISLLIMFFFFDSMQLLFAVCTAIIAT 148
                   :..|..| :.||       ..|....:.:..|| :::::||:|....:.....::.|:
Mouse   251 -------DDFEDAP-MDFT-------PAMTGAVVTMSCSI-MILLYFFYDCFVYVMIGIFSLGAS 299

  Fly   149 VALAFLLLP-MC-------QYIIRPCTDGKRFSF--------GFCGRFTAAELFSFTLSVSIVCI 197
            ..|...|.| :|       |:::    .|:|.|.        |.|...|.              :
Mouse   300 TGLYSCLAPILCHLPLWRYQWVL----PGQRVSVTWPLLLLAGLCAMVTV--------------L 346

  Fly   198 WVLTGH-----WLLMDAMGMGLCVAFIAFVRLPSLKVSTLLLTGLLIYDVFWVFLSSYIFST--N 255
            ||:..:     |||.|.:|:..|:..:..||||:.|..||.|..||.:|||:||::.....|  :
Mouse   347 WVIHRNEDHWAWLLQDTLGVAYCLFVLRRVRLPTFKNCTLFLLALLAFDVFFVFITPLFTKTGES 411

  Fly   256 VMVKVATRPADN------PVGIVARKLHLGGIVRDTPKLNLPGKLVFPSLHNTGHFSMLGLGDVV 314
            :||:||:.|||:      |:.:...:|....:.    ..|.|             ||:||.||:|
Mouse   412 IMVEVASGPADSSSHERLPMVLKVPRLSFSALT----LCNQP-------------FSILGFGDIV 459

  Fly   315 MPGLLLCFVLRYDAYKKAQGVTSDPTLSPPRGVGSRLTYFHCSLLGYFLGLLTATVSSEVFKAAQ 379
            :||.|:.:..|:|..                 |.||..|:....:.|.:|||...|:..:.:..|
Mouse   460 VPGFLVAYCHRFDMQ-----------------VQSRQVYYMACTVAYAVGLLVTFVAMILMQMGQ 507

  Fly   380 PALLYLVPFTLLPLLLMAYLKGDLRRMWSEPFIAQQPSK 418
            |||||||..|||..|.:|..:.:....|:....|:.|::
Mouse   508 PALLYLVSSTLLTSLAVATCRQEFTLFWTGQGRAKIPAE 546

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SppLNP_001163740.1 Peptidase_A22B 102..413 CDD:282158 89/339 (26%)
Sppl2cNP_950184.2 Peptidases_S8_S53 44..181 CDD:299169
Peptidase_A22B 254..538 CDD:294809 92/344 (27%)
PAL 508..510 1/1 (100%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 564..633
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2443
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.