DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp96F and Tsp42Er

DIOPT Version :9

Sequence 1:NP_001262976.1 Gene:Tsp96F / 43127 FlyBaseID:FBgn0027865 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_523644.1 Gene:Tsp42Er / 35629 FlyBaseID:FBgn0033139 Length:211 Species:Drosophila melanogaster


Alignment Length:267 Identity:52/267 - (19%)
Similarity:107/267 - (40%) Gaps:81/267 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 VKYLMVLINILFWLIGLTIVVTSVWMLTDPTFMLSMTQNYNHYHIALYVFLAIGILITLGAFFGC 74
            ::||..|.|.|..::|:..:|.:|         :::.|......:.|.:::|:|.::.|.:||||
  Fly     8 IRYLAFLFNFLCAVLGIATIVVNV---------IAIDQIAPKDQLILGLYIAVGSIVFLLSFFGC 63

  Fly    75 CGVCRESQCLLVSFFCVILIVMVAQIAAGAWAFHNKDKLDDIVRAAVKSSVQEEYGQSTMSSRTV 139
            .|..:||.|:..::...:|::::..|.. .:.|....:.|.|.:.           :...:.:|.
  Fly    64 FGAIKESICVTWAYATSMLVMLIVSIVM-LFVFRMHFEEDSITKL-----------KQAFAKQTN 116

  Fly   140 TFDTL---QKNLKCCGADGPGDWATSRFNNVDRTNIVEIAVSSMNVFYNIPESCCKDNLKDNECE 201
            |||.:   |...:|||.....|:.                    :.:..:|.||...        
  Fly   117 TFDAMAEYQTQYQCCGIYKLKDYG--------------------DAYITVPSSCYDQ-------- 153

  Fly   202 LSRRLKFGGPLNNAIYQQGCVDKLIEIIYE---------NWVTIFAVTAAVILLELLSLTFALSL 257
                       |:..|:.||:.|: |..||         .|:        ::::|:.:.||:..:
  Fly   154 -----------NDTPYRDGCLAKM-ETQYEELLKGPKIVGWM--------LMVIEIGAFTFSTIM 198

  Fly   258 CCAVRNQ 264
            ..::||:
  Fly   199 GVSLRNE 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp96FNP_001262976.1 Tetraspannin 9..261 CDD:278750 50/262 (19%)
CD151_like_LEL 107..233 CDD:239408 23/137 (17%)
Tsp42ErNP_523644.1 Tetraspannin 8..195 CDD:278750 49/255 (19%)
tetraspanin_LEL 93..174 CDD:239401 23/131 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443039
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.