DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp96F and Tsp42Eo

DIOPT Version :9

Sequence 1:NP_001262976.1 Gene:Tsp96F / 43127 FlyBaseID:FBgn0027865 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_523641.2 Gene:Tsp42Eo / 35625 FlyBaseID:FBgn0033136 Length:219 Species:Drosophila melanogaster


Alignment Length:273 Identity:57/273 - (20%)
Similarity:104/273 - (38%) Gaps:83/273 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 CVKYLMVLINILFWLIGLTIVVTSVWMLTDPTFMLSMTQNYNH---YHIALYVFLAIGILITLGA 70
            |:::..|:.:.|..::|:...:..|:.|          ..:|.   .|...:|.|.:...:.|..
  Fly     7 CLQWTSVVFSTLTLIVGVLAALAGVYEL----------DKFNEGSAEHTEKFVQLGMAGALILAG 61

  Fly    71 FFGCCGVCRESQCLLVSFFCVILIVMVAQIAAGAW--AFHNKDKLDDIVRAAVKSSVQEE---YG 130
            ..||.|....|    :....|.||:::|.||:..|  :.:|:.|..|.....|.....:|   :|
  Fly    62 LVGCLGAIFGS----IKVMVVNLILLLALIASHIWKVSHYNETKQLDATEVYVMDLWMKELVHHG 122

  Fly   131 QSTMSSRTVTFDTLQKNLKCCGADGPGDWATSRFNNVDRTNIVEIAVSSMNVFYNIPESC--CKD 193
                     ....||:..:|||..|..|:                  :|:|:  .:|.||  .||
  Fly   123 ---------AMQDLQQEYECCGDKGFSDY------------------TSLNM--KVPRSCFHTKD 158

  Fly   194 NLKDNECELSRRLKFGGPLNNAIYQ--QGCVDKL----IEII-YENWVTIFAVTAAVILLELLSL 251
            .:                  :|:|.  :||:..:    ::|. ||.|     |...:|..|::.:
  Fly   159 GI------------------HALYPYGEGCMAAVKRAYLQIYRYEKW-----VHCGLIGYEVVGI 200

  Fly   252 TFALSLCCAVRNQ 264
            ...::|||.:.|:
  Fly   201 ILGITLCCQLTNK 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp96FNP_001262976.1 Tetraspannin 9..261 CDD:278750 56/268 (21%)
CD151_like_LEL 107..233 CDD:239408 27/137 (20%)
Tsp42EoNP_523641.2 Tetraspannin 7..210 CDD:278750 56/268 (21%)
tetraspanin_LEL 110..178 CDD:239401 21/114 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.