DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp96F and Tsp42El

DIOPT Version :9

Sequence 1:NP_001262976.1 Gene:Tsp96F / 43127 FlyBaseID:FBgn0027865 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_523638.1 Gene:Tsp42El / 35622 FlyBaseID:FBgn0033134 Length:217 Species:Drosophila melanogaster


Alignment Length:265 Identity:65/265 - (24%)
Similarity:106/265 - (40%) Gaps:83/265 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 GCCS-CVKYLMVLINILFWLIGLTIVVTS--VWMLTDPTFMLSMTQNYNHYHIALYVFLAIGILI 66
            ||.: .:||.:.|.|.|:.::|:.:::..  .|.        :|...|           ||||||
  Fly     2 GCATGTIKYSLFLFNALWAILGILVLIFGGLGWG--------AMPDAY-----------AIGILI 47

  Fly    67 TLG-----AFFGCCGVCRESQCLL---VSFFCVILIVMVAQIAAGAWAFHNKDKLDDIVRAAVKS 123
            ..|     :.|||||..|||..:|   .|...::|:::||.|....         .|:.:.....
  Fly    48 LGGTILVISLFGCCGAVRESPRMLWTYASLLLILLLLIVAFIILNP---------KDVFKKYALQ 103

  Fly   124 SVQEEYGQSTMSSRTVTFDTLQKNLKCCGADGPGDWATSRF-NNVDRTNIVEIAVSSMNVFYNIP 187
            :|:.::  ....::..:.|.:||...|||.|...|:...:| ||                  .:|
  Fly   104 TVENQW--ELEQTKPGSMDIIQKTYYCCGRDSAQDYLDIKFWNN------------------TVP 148

  Fly   188 ESCCKDNLKDNECELSRRLKFGGPLNNAIYQQGCVDKLIEII--------YENWVTIFAVTAAVI 244
            .|||||:...|            |||  :|.:||:.|:.|..        |..| .:....|.::
  Fly   149 SSCCKDDSCVN------------PLN--LYVRGCLIKVEEAFADEATTLGYLEW-GLLGFNAVIL 198

  Fly   245 LLELL 249
            ||.::
  Fly   199 LLAII 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp96FNP_001262976.1 Tetraspannin 9..261 CDD:278750 63/260 (24%)
CD151_like_LEL 107..233 CDD:239408 29/134 (22%)
Tsp42ElNP_523638.1 Tetraspannin 7..196 CDD:278750 60/251 (24%)
tetraspanin_LEL 94..178 CDD:239401 28/117 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443048
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.