DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5890 and GUCA1C

DIOPT Version :9

Sequence 1:NP_001356889.1 Gene:CG5890 / 43126 FlyBaseID:FBgn0039380 Length:229 Species:Drosophila melanogaster
Sequence 2:NP_005450.3 Gene:GUCA1C / 9626 HGNCID:4680 Length:209 Species:Homo sapiens


Alignment Length:166 Identity:53/166 - (31%)
Similarity:93/166 - (56%) Gaps:11/166 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 QEIRVMYRGFKTECPEGV--VHEDCFKDIYAKFFPHGNSSLYAHYVFKAFDVNCNGAISFRDLLV 103
            ||..|.||.|..|.|.|:  :||  ||.:......:..::.:...|:..||.|.:|.:.|.:.:.
Human    17 QETHVWYRTFMMEYPSGLQTLHE--FKTLLGLQGLNQKANKHIDQVYNTFDTNKDGFVDFLEFIA 79

  Fly   104 TLSTLLRGSVYERLRWTFKLYDLNGDGRISRGELSEIILAIHELMGRRPHQPEDDRKARDQVDRV 168
            .::.:::..:.::|:|.|||||.:|:|.|.:.||.::.:|:..|.|::...||      :.::.|
Human    80 AVNLIMQEKMEQKLKWYFKLYDADGNGSIDKNELLDMFMAVQALNGQQTLSPE------EFINLV 138

  Fly   169 FRKLDLNQDGIITIEEFLEACLKD-DLVTRSLQMFD 203
            |.|:|:|.||.:|:|||:....|| ||:....:.||
Human   139 FHKIDINNDGELTLEEFINGMAKDQDLLEIVYKSFD 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5890NP_001356889.1 FRQ1 29..192 CDD:227455 47/152 (31%)
GUCA1CNP_005450.3 FRQ1 15..165 CDD:227455 49/155 (32%)
EFh 56..118 CDD:238008 18/61 (30%)
EFh 92..160 CDD:238008 28/73 (38%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 187..209
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143256
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000038
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X31
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.