DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5890 and FRQ1

DIOPT Version :9

Sequence 1:NP_001356889.1 Gene:CG5890 / 43126 FlyBaseID:FBgn0039380 Length:229 Species:Drosophila melanogaster
Sequence 2:NP_010661.3 Gene:FRQ1 / 851979 SGDID:S000002781 Length:190 Species:Saccharomyces cerevisiae


Alignment Length:184 Identity:65/184 - (35%)
Similarity:111/184 - (60%) Gaps:3/184 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 KPIPVALEDL-C--RQTKFTKQEIRVMYRGFKTECPEGVVHEDCFKDIYAKFFPHGNSSLYAHYV 84
            |...::.:|| |  :.|.|.::||:..::||..:||.|.:..:.|..||.:|||.|:...:|:::
Yeast     4 KTSKLSKDDLTCLKQSTYFDRREIQQWHKGFLRDCPSGQLAREDFVKIYKQFFPFGSPEDFANHL 68

  Fly    85 FKAFDVNCNGAISFRDLLVTLSTLLRGSVYERLRWTFKLYDLNGDGRISRGELSEIILAIHELMG 149
            |..||.:.||.|.|.:.:..|||..||::.|:|.|.|:|||||.||.|:..|:..|:.:::::||
Yeast    69 FTVFDKDNNGFIHFEEFITVLSTTSRGTLEEKLSWAFELYDLNHDGYITFDEMLTIVASVYKMMG 133

  Fly   150 RRPHQPEDDRKARDQVDRVFRKLDLNQDGIITIEEFLEACLKDDLVTRSLQMFD 203
            ......||:.....:|.::|:.:|.|:||.||::||.|....|..:..:|.::|
Yeast   134 SMVTLNEDEATPEMRVKKIFKLMDKNEDGYITLDEFREGSKVDPSIIGALNLYD 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5890NP_001356889.1 FRQ1 29..192 CDD:227455 61/165 (37%)
FRQ1NP_010661.3 FRQ1 4..179 CDD:227455 63/174 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000038
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23055
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X31
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.