DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5890 and CPK30

DIOPT Version :9

Sequence 1:NP_001356889.1 Gene:CG5890 / 43126 FlyBaseID:FBgn0039380 Length:229 Species:Drosophila melanogaster
Sequence 2:NP_177612.2 Gene:CPK30 / 843813 AraportID:AT1G74740 Length:541 Species:Arabidopsis thaliana


Alignment Length:98 Identity:26/98 - (26%)
Similarity:48/98 - (48%) Gaps:12/98 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 DVNCNGAISFRDLLVTLSTLLRGSVYERLRWTFKLYDLNGDGRISRGELSEIILAIHELMGRRPH 153
            |||.||.:.:.:.:..:..|.:....|..|..|..:|.:|.|.|...||.|   |:.:.:|    
plant   409 DVNGNGCLDYGEFVAVIIHLQKMENDEHFRQAFMFFDKDGSGYIESEELRE---ALTDELG---- 466

  Fly   154 QPEDDRKARDQVDRVFRKLDLNQDGIITIEEFL 186
            :|::     ..:..:.|::|.::||.|..:||:
plant   467 EPDN-----SVIIDIMREVDTDKDGKINYDEFV 494

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5890NP_001356889.1 FRQ1 29..192 CDD:227455 26/98 (27%)
CPK30NP_177612.2 STKc_CAMK 58..316 CDD:270687
PTZ00184 353..497 CDD:185504 26/98 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.