DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5890 and CBL8

DIOPT Version :9

Sequence 1:NP_001356889.1 Gene:CG5890 / 43126 FlyBaseID:FBgn0039380 Length:229 Species:Drosophila melanogaster
Sequence 2:NP_001319319.1 Gene:CBL8 / 842756 AraportID:AT1G64480 Length:214 Species:Arabidopsis thaliana


Alignment Length:201 Identity:55/201 - (27%)
Similarity:99/201 - (49%) Gaps:28/201 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 YELEHTRVPKPIPVALED---LCRQTKFTKQEIRVMYRGFK----TECPEGVVHEDCFKDIYAKF 71
            :.|:..:.|:    ..||   |..:|.||..||..::..||    :...:|::|::.|  :.|.|
plant     8 FSLKRAKHPR----GYEDPHVLASETPFTVNEIEALHDLFKKLSTSIINDGLIHKEEF--LLALF 66

  Fly    72 FPHGNSSLYAHYVFKAFDVNCNGAISFRDLLVTLSTLLRGS-VYERLRWTFKLYDLNGDGRISRG 135
            ......:|:|..||..||...||.|.|.:.:.:||.....: .:|:..:.|||:||:|.|.|...
plant    67 RNGSMQNLFADRVFYMFDRKRNGVIEFGEFVRSLSIFHPYTPEHEKSAFMFKLFDLHGTGFIEPH 131

  Fly   136 ELSEIILAIHELMGRRPHQPEDDRKARDQ-----VDRVFRKLDLNQDGIITIEEFLEACLKDDLV 195
            ||.:::.|   |:|      |.|.:..::     |::...::|.|:||.|..||:.|...|:..:
plant   132 ELKKMVGA---LLG------ETDLELSEESIEAIVEQTMLEVDTNKDGKIDEEEWKELVAKNPSI 187

  Fly   196 TRSLQM 201
            .:::.:
plant   188 LKNMTL 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5890NP_001356889.1 FRQ1 29..192 CDD:227455 52/175 (30%)
CBL8NP_001319319.1 FRQ1 29..187 CDD:227455 50/168 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 51 1.000 Domainoid score I4318
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 86 1.000 Inparanoid score I2330
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1040
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X31
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.960

Return to query results.
Submit another query.