DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5890 and CBL9

DIOPT Version :9

Sequence 1:NP_001356889.1 Gene:CG5890 / 43126 FlyBaseID:FBgn0039380 Length:229 Species:Drosophila melanogaster
Sequence 2:NP_199521.1 Gene:CBL9 / 834756 AraportID:AT5G47100 Length:213 Species:Arabidopsis thaliana


Alignment Length:171 Identity:45/171 - (26%)
Similarity:85/171 - (49%) Gaps:21/171 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 LCRQTKFTKQEIRVMYRGFK----TECPEGVVHEDCFKDIYAKFFPHGNSSLYAHYVFKAFDVNC 92
            |..:|.|:..|:..:|..||    :...:|:::::.|:  .|.|......:|:|:.:|..|||..
plant    21 LASETAFSVSEVEALYELFKSISSSVVDDGLINKEEFQ--LALFKNRKKENLFANRIFDLFDVKR 83

  Fly    93 NGAISFRDLLVTLSTL-LRGSVYERLRWTFKLYDLNGDGRISRGELSEIILAIHELMGRRPHQPE 156
            .|.|.|.|.:.:|:.. ...|:.|:..:||:|||::..|.|.|.|:.::::|:         ..|
plant    84 KGVIDFGDFVRSLNVFHPNASLEEKTDFTFRLYDMDCTGFIERQEVKQMLIAL---------LCE 139

  Fly   157 DDRKARDQ-----VDRVFRKLDLNQDGIITIEEFLEACLKD 192
            .:.|..|.     :|:.|...|:::||.|...|:....:|:
plant   140 SEMKLADDTIEMILDQTFEDADVDRDGKIDKTEWSNFVIKN 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5890NP_001356889.1 FRQ1 29..192 CDD:227455 44/169 (26%)
CBL9NP_199521.1 FRQ1 25..183 CDD:227455 44/167 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 86 1.000 Inparanoid score I2330
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1040
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X31
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.960

Return to query results.
Submit another query.