DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5890 and AT4G34070

DIOPT Version :9

Sequence 1:NP_001356889.1 Gene:CG5890 / 43126 FlyBaseID:FBgn0039380 Length:229 Species:Drosophila melanogaster
Sequence 2:NP_195133.3 Gene:AT4G34070 / 829553 AraportID:AT4G34070 Length:313 Species:Arabidopsis thaliana


Alignment Length:227 Identity:48/227 - (21%)
Similarity:89/227 - (39%) Gaps:52/227 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 RQTKFTKQEIRVMYRGFKTECPEG------VVHEDCF------------KDIYAKFF-----PHG 75
            |:|:.||....:  ||.|....:|      |.|  ||            .|:.:.||     ...
plant    27 RRTETTKPAGEL--RGEKNPAKKGNSNSSSVDH--CFTSASRAFTQKKLADLKSLFFSLASKSQS 87

  Fly    76 NSSLYAHYVF------------KAFDV----NCNGAISFRDLLVTLSTLLRGSVYERLRWTFKLY 124
            |....::.||            :.||:    ..:..::|.||::..:|..:|:..|...:.::..
plant    88 NDQYVSYPVFQEYFGLSGSLGERIFDMVTQHRKDDKMTFEDLVIAKATYEKGTDDEIAEFIYQTL 152

  Fly   125 DLNGDGRISRGELSEIILAIHELMGRRPHQPEDDRKARDQVDRV-----FRKLDLNQDGIITIEE 184
            |:||:|.:.|.:|...::.|.:.:........:....::.||.:     |.|.|...:..::.|:
plant   153 DVNGNGVLRRSDLESFLVVILKSVFSTESSDAESSDYKEMVDALLDAATFSKSDDGSEKGMSFED 217

  Fly   185 FLEACLKDDLVTRSLQMFDNDLXXQEGELEPG 216
            |...|   .||. :::.|...|....|.:.||
plant   218 FRSWC---PLVP-TIRKFLGSLLIPPGPVRPG 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5890NP_001356889.1 FRQ1 29..192 CDD:227455 41/201 (20%)
AT4G34070NP_195133.3 EF-hand_7 145..222 CDD:290234 14/76 (18%)
TLD 261..>312 CDD:295191
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1513542at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.