DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5890 and CBL10

DIOPT Version :9

Sequence 1:NP_001356889.1 Gene:CG5890 / 43126 FlyBaseID:FBgn0039380 Length:229 Species:Drosophila melanogaster
Sequence 2:NP_195026.1 Gene:CBL10 / 829437 AraportID:AT4G33000 Length:256 Species:Arabidopsis thaliana


Alignment Length:169 Identity:50/169 - (29%)
Similarity:85/169 - (50%) Gaps:25/169 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 LEDLCRQTKFTKQEIRVMYRGF-KTEC---PEGVVHEDCFKDIYAKFF--PHGNSSLYAHYVFKA 87
            ||.|.|:::|:..|:..:|..| |..|   .:|::|::   ::....|  |:| .:|:...||..
plant    64 LERLARESQFSVNEVEALYELFKKLSCSIIDDGLIHKE---ELRLALFQAPYG-ENLFLDRVFDL 124

  Fly    88 FDVNCNGAISFRDLLVTLSTL-LRGSVYERLRWTFKLYDLNGDGRISRGELSEIILAIHELMGRR 151
            ||...||.|.|.:.:..||.. ...|:.|:..:.|:||||...|.|.|.|:.:::.||  |:   
plant   125 FDEKKNGVIEFEEFIHALSVFHPYASIQEKTDFAFRLYDLRQTGFIEREEVQQMVSAI--LL--- 184

  Fly   152 PHQPEDDRKARDQ-----VDRVFRKLDLNQDGIITIEEF 185
                |.|....|:     :|:.|...|.::||.|:.:|:
plant   185 ----ESDMMLSDELLTMIIDKTFADADSDKDGKISKDEW 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5890NP_001356889.1 FRQ1 29..192 CDD:227455 50/169 (30%)
CBL10NP_195026.1 EF-hand_7 81..142 CDD:290234 18/64 (28%)
EFh 118..180 CDD:238008 21/61 (34%)
EF-hand_7 118..179 CDD:290234 21/60 (35%)
EFh 154..219 CDD:238008 21/73 (29%)
EF-hand_7 158..218 CDD:290234 21/68 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 86 1.000 Inparanoid score I2330
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1040
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X31
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.960

Return to query results.
Submit another query.