DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5890 and CBL7

DIOPT Version :9

Sequence 1:NP_001356889.1 Gene:CG5890 / 43126 FlyBaseID:FBgn0039380 Length:229 Species:Drosophila melanogaster
Sequence 2:NP_194386.1 Gene:CBL7 / 828763 AraportID:AT4G26560 Length:214 Species:Arabidopsis thaliana


Alignment Length:181 Identity:47/181 - (25%)
Similarity:85/181 - (46%) Gaps:21/181 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 FTKQEIR-VMYRGFK----TECP--EGVVHE--DCF-----KDIY--AKFFPHGNSSLYAHYVFK 86
            ||.|:.| .:|..||    .:|.  ||.|.|  .|:     |:.:  |.|....|.||::..||.
plant    16 FTDQKKRKALYEVFKKLSGVDCQRNEGNVVEGVTCYYGEMNKEQFHVAIFQTDKNESLFSERVFD 80

  Fly    87 AFDVNCNGAISFRDLLVTLSTLLRGS-VYERLRWTFKLYDLNGDGRISRGELSEIILAIHELMGR 150
            .||.|.:|.:.|.:....||.....: :.:::..:|:||||...|.|.|..:.::::|.....| 
plant    81 LFDTNHDGLLGFEEFARALSVFHPSAPIDDKIDLSFQLYDLKQQGFIERQGVKQLVVATLAASG- 144

  Fly   151 RPHQPEDDRKARDQVDRVFRKLDLNQDGIITIEEFLEACLKDDLVTRSLQM 201
               ..:.|......:|:.|.:.|...:|:|..||:::...:..|:.:::.:
plant   145 ---MSQSDEIVESIIDKTFVQADTKHEGMIDEEEWMDLVFRHPLLLKNMTL 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5890NP_001356889.1 FRQ1 29..192 CDD:227455 46/170 (27%)
CBL7NP_194386.1 FRQ1 <74..186 CDD:227455 27/115 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 86 1.000 Inparanoid score I2330
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1040
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X31
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.960

Return to query results.
Submit another query.