DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5890 and CBL6

DIOPT Version :9

Sequence 1:NP_001356889.1 Gene:CG5890 / 43126 FlyBaseID:FBgn0039380 Length:229 Species:Drosophila melanogaster
Sequence 2:NP_001328805.1 Gene:CBL6 / 827330 AraportID:AT4G16350 Length:226 Species:Arabidopsis thaliana


Alignment Length:173 Identity:47/173 - (27%)
Similarity:82/173 - (47%) Gaps:7/173 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 EDLCRQTKFTKQEIRVMYRGFKTECPEGVVHEDCFKDIYAKFFPHGNSSLYAHYVFKAFDVNCNG 94
            :|:.|.|.||..||..:|..||:....|::.::.|:.:..|.  :...||:|..||..||....|
plant    32 KDVARGTVFTVNEIEALYELFKSISKNGLIDKEQFQLVLFKM--NTTRSLFADRVFDLFDTKNTG 94

  Fly    95 AISFRDLLVTLSTLLRGSVYE-RLRWTFKLYDLNGDGRISRGELSEIILAIHELMGRRPHQPEDD 158
            .:.|.....:||.....:.:| ::.::|||||||..|.|.|.|:.::::......|..    ..|
plant    95 ILDFEAFARSLSVFHPNAKFEDKIEFSFKLYDLNQQGYIKRQEVKQMVVRTLAESGMN----LSD 155

  Fly   159 RKARDQVDRVFRKLDLNQDGIITIEEFLEACLKDDLVTRSLQM 201
            ......:|:.|.:.|...||.|..||:....|:...:.:::.:
plant   156 HVIESIIDKTFEEADTKLDGKIDKEEWRSLVLRHPSLLQNMSL 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5890NP_001356889.1 FRQ1 29..192 CDD:227455 47/162 (29%)
CBL6NP_001328805.1 FRQ1 38..192 CDD:227455 45/159 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 86 1.000 Inparanoid score I2330
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1040
orthoMCL 1 0.900 - - OOG6_101448
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X31
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.860

Return to query results.
Submit another query.