DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5890 and CBL5

DIOPT Version :9

Sequence 1:NP_001356889.1 Gene:CG5890 / 43126 FlyBaseID:FBgn0039380 Length:229 Species:Drosophila melanogaster
Sequence 2:NP_192051.2 Gene:CBL5 / 826671 AraportID:AT4G01420 Length:203 Species:Arabidopsis thaliana


Alignment Length:167 Identity:46/167 - (27%)
Similarity:79/167 - (47%) Gaps:27/167 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 LCRQTKFTKQEIRVMYRGF--KTEC--PEGVVHEDCFKDIYAKFFPHGNS---SLYAHYVFKAFD 89
            |..||.|::.|:.|::..|  .|.|  .:.::.::.|:.|..|     |:   ||.|..:|..||
plant    20 LASQTFFSEAEVEVLHGLFIKLTSCLSNDNLLTKEKFQFILIK-----NTKKRSLSAERIFGLFD 79

  Fly    90 VNCNGAISFRDLLVTLSTL-LRGSVYERLRWTFKLYDLNGDGRISRGELSEIILAIHELMGRRPH 153
            :..:|||.|.:.:.||:.. ...|..::..:.|:|||....|.|...|:.|:|:.:.|       
plant    80 MRNDGAIDFGEFVHTLNIFHPNSSPRDKAIFAFRLYDTRETGFIEPEEVKEMIIDVLE------- 137

  Fly   154 QPEDDRKARDQ-----VDRVFRKLDLNQDGIITIEEF 185
              |.:....:.     |.:.|.:.|..:||||.:||:
plant   138 --ESELMLSESIIDSIVSKTFEEADWKKDGIIDLEEW 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5890NP_001356889.1 FRQ1 29..192 CDD:227455 46/167 (28%)
CBL5NP_192051.2 FRQ1 13..181 CDD:227455 46/167 (28%)
EFh 71..132 CDD:298682 19/60 (32%)
EFh 107..172 CDD:238008 19/73 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 51 1.000 Domainoid score I4318
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 86 1.000 Inparanoid score I2330
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1040
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X31
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.960

Return to query results.
Submit another query.