DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5890 and AT3G03410

DIOPT Version :9

Sequence 1:NP_001356889.1 Gene:CG5890 / 43126 FlyBaseID:FBgn0039380 Length:229 Species:Drosophila melanogaster
Sequence 2:NP_186991.1 Gene:AT3G03410 / 821262 AraportID:AT3G03410 Length:131 Species:Arabidopsis thaliana


Alignment Length:137 Identity:28/137 - (20%)
Similarity:58/137 - (42%) Gaps:21/137 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 EGVVHEDCFKDIYAKFFPHGNSSLYAHYVFKAFDVNCNGAISFRDLLVTLSTLLRGSVYERLRWT 120
            :|.:..|.|:::...|.|:........: |:..||:.||.::..:....:..:|:.        .
plant    15 DGKLSLDEFREVALAFSPYFTQEDIVKF-FEEIDVDGNGELNADEFTSCIEKMLKE--------V 70

  Fly   121 FKLYDLNGDGRISRGELSEIILAIHELMGRRPHQPEDDRKARDQVDRVFRKLDLNQDGIITIEEF 185
            |...|::|||:|...| |.:.:.   .:|::..:.....|.        |..|::.||.:..:||
plant    71 FVFCDVDGDGKIPASE-SYVTMT---SLGKKFTEETSAEKV--------RAADVDGDGYLNFDEF 123

  Fly   186 LEACLKD 192
            :...:.|
plant   124 MALVIGD 130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5890NP_001356889.1 FRQ1 29..192 CDD:227455 27/135 (20%)
AT3G03410NP_186991.1 PTZ00184 4..128 CDD:185504 27/133 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X31
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.