DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5890 and Cib1

DIOPT Version :9

Sequence 1:NP_001356889.1 Gene:CG5890 / 43126 FlyBaseID:FBgn0039380 Length:229 Species:Drosophila melanogaster
Sequence 2:XP_038948271.1 Gene:Cib1 / 81823 RGDID:620133 Length:203 Species:Rattus norvegicus


Alignment Length:196 Identity:47/196 - (23%)
Similarity:89/196 - (45%) Gaps:37/196 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 TRVPKPIPVALEDLCRQTKFTKQEIRVMYRGFKTEC----PEGVVHED------CFKDIYAKFFP 73
            :|:.|.:....:||   |..|||||.:.:|.|   |    ||....|:      .|:.|.:  .|
  Rat     6 SRLSKELLAEYQDL---TFLTKQEILLAHRRF---CELLPPEHRTVEESLHTRVSFEQILS--LP 62

  Fly    74 HGNSSLYAHYVFKAFDVN-CNGAISFRDLLVTLSTLLRGSVYE-RLRWTFKLYDLNGDGRISRGE 136
            ...::.:...:...|..: ...::||.|.|..||.....:..: :..:.|:::|.:.||.:.|.:
  Rat    63 ELKANPFKERICMVFSTSPTRDSLSFEDFLDLLSVFSDTATPDIKSHYAFRIFDFDDDGTLDRED 127

  Fly   137 LSEIILAIHELMGRRPHQPEDDR----KARDQVDRVFRKLDLNQDGIITIEEFLEACLKDDLVTR 197
            ||.:   ::.|.|    :.||.|    :.:..:|.:..:.|:::||.|.:.||      ..:::|
  Rat   128 LSRL---VNCLTG----EGEDTRLSASEMKQLIDNILEESDIDRDGTINLSEF------QHVISR 179

  Fly   198 S 198
            |
  Rat   180 S 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5890NP_001356889.1 FRQ1 29..192 CDD:227455 43/178 (24%)
Cib1XP_038948271.1 EFh 111..178 CDD:238008 19/79 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X31
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.