DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5890 and Kcnip4

DIOPT Version :9

Sequence 1:NP_001356889.1 Gene:CG5890 / 43126 FlyBaseID:FBgn0039380 Length:229 Species:Drosophila melanogaster
Sequence 2:XP_030110777.1 Gene:Kcnip4 / 80334 MGIID:1933131 Length:256 Species:Mus musculus


Alignment Length:170 Identity:79/170 - (46%)
Similarity:119/170 - (70%) Gaps:5/170 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 ASPP-ESPIEEVVYELEHTRVPKPIPVALEDLCRQTKFTKQEIRVMYRGFKTECPEGVVHEDCFK 65
            :||. ::.:|:   |||...| :..|.|||.|..|:||||:|::::|||||.|||.|||:|:.||
Mouse    49 SSPAIQNSVED---ELEMATV-RHRPEALELLEAQSKFTKKELQILYRGFKNECPSGVVNEETFK 109

  Fly    66 DIYAKFFPHGNSSLYAHYVFKAFDVNCNGAISFRDLLVTLSTLLRGSVYERLRWTFKLYDLNGDG 130
            :||::|||.|:|:.|||::|.|||.:.|||:||.|.:..||.||||:|.|:|.|.|.|||:|.||
Mouse   110 EIYSQFFPQGDSTTYAHFLFNAFDTDHNGAVSFEDFIKGLSILLRGTVQEKLNWAFNLYDINKDG 174

  Fly   131 RISRGELSEIILAIHELMGRRPHQPEDDRKARDQVDRVFR 170
            .|::.|:.:|:.||:::||:..:....:...|..|:..|:
Mouse   175 YITKEEMLDIMKAIYDMMGKCTYPVLKEDAPRQHVETFFQ 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5890NP_001356889.1 FRQ1 29..192 CDD:227455 70/142 (49%)
Kcnip4XP_030110777.1 FRQ1 80..>186 CDD:227455 59/105 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167833427
Domainoid 1 1.000 96 1.000 Domainoid score I7294
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 212 1.000 Inparanoid score I3634
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D606780at33208
OrthoFinder 1 1.000 - - FOG0000038
OrthoInspector 1 1.000 - - otm42579
orthoMCL 1 0.900 - - OOG6_101448
Panther 1 1.100 - - O PTHR23055
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5210
SonicParanoid 1 1.000 - - X31
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1211.930

Return to query results.
Submit another query.