DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5890 and EFCAB1

DIOPT Version :9

Sequence 1:NP_001356889.1 Gene:CG5890 / 43126 FlyBaseID:FBgn0039380 Length:229 Species:Drosophila melanogaster
Sequence 2:NP_078869.1 Gene:EFCAB1 / 79645 HGNCID:25678 Length:211 Species:Homo sapiens


Alignment Length:131 Identity:37/131 - (28%)
Similarity:79/131 - (60%) Gaps:6/131 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 VFKAFDVNCNGAISFRDLLVTLSTLLRGSVYERLRWTFKLYDLNGDGRISRGELSEIILAIHELM 148
            ||:.||.:.:|.::..:.:..||..||||:.|::::.|:::||||||.||:.|:..::.  :.|:
Human    72 VFRGFDKDNDGCVNVLEWIHGLSLFLRGSLEEKMKYCFEVFDLNGDGFISKEEMFHMLK--NSLL 134

  Fly   149 GRRPHQPEDDRKARDQVDRVFRKLDLNQDGIITIEEFLEACLKDDLVTRSLQMFDNDLXXQEGEL 213
             ::|.:.:.|...:|.|:...:|:|.:.||.::..:: |..::::  |..|:.|...|...:.::
Human   135 -KQPSEEDPDEGIKDLVEITLKKMDHDHDGKLSFADY-ELAVREE--TLLLEAFGPCLPDPKSQM 195

  Fly   214 E 214
            |
Human   196 E 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5890NP_001356889.1 FRQ1 29..192 CDD:227455 32/107 (30%)
EFCAB1NP_078869.1 EFh_PEF <48..170 CDD:330173 31/100 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143265
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X31
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.