DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5890 and Duox2

DIOPT Version :9

Sequence 1:NP_001356889.1 Gene:CG5890 / 43126 FlyBaseID:FBgn0039380 Length:229 Species:Drosophila melanogaster
Sequence 2:NP_077055.2 Gene:Duox2 / 79107 RGDID:628761 Length:1517 Species:Rattus norvegicus


Alignment Length:132 Identity:35/132 - (26%)
Similarity:64/132 - (48%) Gaps:22/132 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 LYAHYVFKAFDVNCNGAISFRDLLVTLSTLLRGSVYERLRWTFKLYDLNGDGRISRGELSEIILA 143
            ::...:|...|.:.||.||||:.|..|...::||..::.|..|.:|||:|:|.:|:.|...::.:
  Rat   822 MFVESMFSLADKDGNGYISFREFLDILVVFMKGSPQDKSRLMFTMYDLDGNGFLSKEEFFTMMRS 886

  Fly   144 IHELMGRRPHQPEDDRKARDQ----VDRVFRKLDLNQDGIITIEEFLEACLKDDLVTRSLQMFDN 204
            ..|:        .::..::||    |:.:||:........:|.|:| ...|:|         .|:
  Rat   887 FIEI--------SNNCLSKDQLAEVVESMFRESGFQDKEELTWEDF-HFMLRD---------HDS 933

  Fly   205 DL 206
            ||
  Rat   934 DL 935

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5890NP_001356889.1 FRQ1 29..192 CDD:227455 31/116 (27%)
Duox2NP_077055.2 Peroxidase-like, mediates peroxidase activity. /evidence=ECO:0000250 30..596
dual_peroxidase_like 38..594 CDD:188652
FRQ1 <719..856 CDD:227455 11/33 (33%)
EFh 824..885 CDD:238008 21/60 (35%)
EFh 861..919 CDD:238008 15/65 (23%)
Interaction with TXNDC11. /evidence=ECO:0000250 960..1214
Ferric_reduct 1057..1201 CDD:396386
NOX_Duox_like_FAD_NADP 1243..1517 CDD:99783
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.