DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5890 and hpcal4

DIOPT Version :9

Sequence 1:NP_001356889.1 Gene:CG5890 / 43126 FlyBaseID:FBgn0039380 Length:229 Species:Drosophila melanogaster
Sequence 2:NP_001072798.1 Gene:hpcal4 / 780259 XenbaseID:XB-GENE-995790 Length:191 Species:Xenopus tropicalis


Alignment Length:182 Identity:74/182 - (40%)
Similarity:119/182 - (65%) Gaps:6/182 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 KPIPVALEDLCRQTKFTKQEIRVMYRGFKTECPEGVVHEDCFKDIYAKFFPHGNSSLYAHYVFKA 87
            |..|..|:||.:.|:|::||::..|:||..:||.|:::...|:.:|.||||:|::|.:|.:.|:.
 Frog     7 KLAPEMLQDLVQSTEFSEQELKHWYKGFLKDCPSGILNLQEFQQLYIKFFPYGDASKFAQHAFRT 71

  Fly    88 FDVNCNGAISFRDLLVTLSTLLRGSVYERLRWTFKLYDLNGDGRISRGELSEIILAIHELMG--- 149
            ||.|.:|.|.||:.:..||...|||..::|.|.|::|||:|||:|:|.|:.|||.||::::|   
 Frog    72 FDKNGDGTIDFREFICALSVTSRGSFEQKLNWAFEMYDLDGDGKITRLEMLEIIEAIYKMVGTVI 136

  Fly   150 -RRPHQPEDDRKARDQVDRVFRKLDLNQDGIITIEEFLEACLKDDLVTRSLQ 200
             .|.:|  |....:.:||::|.|:|.::|..||:|||.||...|..:...||
 Frog   137 MMRMNQ--DGLTPQQRVDKIFAKMDKDRDDQITLEEFKEAAKSDPSIVLLLQ 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5890NP_001356889.1 FRQ1 29..192 CDD:227455 69/166 (42%)
hpcal4NP_001072798.1 FRQ1 13..181 CDD:227455 70/169 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000038
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X31
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.