DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5890 and vsnl1

DIOPT Version :9

Sequence 1:NP_001356889.1 Gene:CG5890 / 43126 FlyBaseID:FBgn0039380 Length:229 Species:Drosophila melanogaster
Sequence 2:XP_031757643.1 Gene:vsnl1 / 779779 XenbaseID:XB-GENE-952045 Length:205 Species:Xenopus tropicalis


Alignment Length:199 Identity:75/199 - (37%)
Similarity:120/199 - (60%) Gaps:6/199 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 PIEEVVYELEHTRVPKP----IPVALEDLCRQTKFTKQEIRVMYRGFKTECPEGVVHEDCFKDIY 68
            |:..:.:.|...::.|.    .|..:|||.:.|:|.:.|::..|:||..:||.|.::.|.|:.:|
 Frog     2 PLAVIFHLLSGNKMGKQNSKLAPEVMEDLVKSTEFNEHELKQWYKGFLKDCPSGRLNLDEFQQLY 66

  Fly    69 AKFFPHGNSSLYAHYVFKAFDVNCNGAISFRDLLVTLSTLLRGSVYERLRWTFKLYDLNGDGRIS 133
            .||||:|::|.:|.:.|:.||.|.:|.|.||:.:..||...|||..::|.|.|.:|||:|||:|:
 Frog    67 VKFFPYGDASKFAQHAFRTFDKNGDGTIDFREFICALSITSRGSFEQKLNWAFNMYDLDGDGKIT 131

  Fly   134 RGELSEIILAIHELMGR--RPHQPEDDRKARDQVDRVFRKLDLNQDGIITIEEFLEACLKDDLVT 196
            |.|:.|||.||::::|.  .....||......:||::|.|:|.|:|..||::||.||...|..:.
 Frog   132 RVEMLEIIEAIYKMVGTVIMMKMNEDGLTPEQRVDKIFSKMDKNKDDQITLDEFKEAAKSDPSIV 196

  Fly   197 RSLQ 200
            ..||
 Frog   197 LLLQ 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5890NP_001356889.1 FRQ1 29..192 CDD:227455 68/164 (41%)
vsnl1XP_031757643.1 FRQ1 29..195 CDD:227455 68/165 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000038
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X31
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.