DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5890 and 1700109H08Rik

DIOPT Version :9

Sequence 1:NP_001356889.1 Gene:CG5890 / 43126 FlyBaseID:FBgn0039380 Length:229 Species:Drosophila melanogaster
Sequence 2:NP_084119.1 Gene:1700109H08Rik / 77036 MGIID:1924286 Length:210 Species:Mus musculus


Alignment Length:177 Identity:49/177 - (27%)
Similarity:92/177 - (51%) Gaps:16/177 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 LEDLCRQTK-FTKQEIRVMYRGFKT--ECPEGVVHE---DC--FKDIYAKFFPHGNSSLYAHYVF 85
            :|.:.:..| |.|.|:..:.|.|.:  .||.|.:..   ||  |:.:....|...|..| .:.||
Mouse    10 VESIRKTVKSFKKFEVECLIRLFYSLVGCPVGKMDNTGLDCNTFRGVLQNIFGMTNDML-MNRVF 73

  Fly    86 KAFDVNCNGAISFRDLLVTLSTLLRGSVYERLRWTFKLYDLNGDGRISRGELSEIILAIHELMGR 150
            ..||.:.:|.::..:.:..|:..|||:..|::|:.|::|.||||..||:.::.:::.:     ..
Mouse    74 FVFDKDGDGYVNLEEWIKGLAVFLRGTFEEKMRFCFEVYYLNGDAYISQEKIFDMLKS-----SL 133

  Fly   151 RPHQPEDDRK--ARDQVDRVFRKLDLNQDGIITIEEFLEACLKDDLV 195
            ..|.||::.:  .:|.|:...:|:|.:.||.|:..:|.:|..:|.|:
Mouse   134 FQHSPEEENEEGVKDLVEISLKKMDYDNDGKISFADFEKAVKEDGLL 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5890NP_001356889.1 FRQ1 29..192 CDD:227455 47/172 (27%)
1700109H08RikNP_084119.1 EFh 71..130 CDD:298682 19/58 (33%)
EF-hand_7 105..174 CDD:290234 20/73 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167833417
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X31
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.