powered by:
Protein Alignment CG5890 and znf852
DIOPT Version :9
Sequence 1: | NP_001356889.1 |
Gene: | CG5890 / 43126 |
FlyBaseID: | FBgn0039380 |
Length: | 229 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001039058.1 |
Gene: | znf852 / 733842 |
XenbaseID: | XB-GENE-6460608 |
Length: | 373 |
Species: | Xenopus tropicalis |
Alignment Length: | 66 |
Identity: | 18/66 - (27%) |
Similarity: | 24/66 - (36%) |
Gaps: | 27/66 - (40%) |
- Green bases have known domain annotations that are detailed below.
Fly 17 EHTRVPKPIPVALEDLCRQTKFTKQEIRVMYRGFKTECPEGVVHEDCFKDIYAKFFPHGNSSLYA 81
||.|...| |....:|.::.:|. ||| .|.|||: ||.|.:
Frog 58 EHQRSRSP-PTHGRNLRKRQQFF--------------CPE---CERCFKN---------NSELES 95
Fly 82 H 82
|
Frog 96 H 96
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C165162837 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.930 |
|
Return to query results.
Submit another query.