DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5890 and znf852

DIOPT Version :9

Sequence 1:NP_001356889.1 Gene:CG5890 / 43126 FlyBaseID:FBgn0039380 Length:229 Species:Drosophila melanogaster
Sequence 2:NP_001039058.1 Gene:znf852 / 733842 XenbaseID:XB-GENE-6460608 Length:373 Species:Xenopus tropicalis


Alignment Length:66 Identity:18/66 - (27%)
Similarity:24/66 - (36%) Gaps:27/66 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 EHTRVPKPIPVALEDLCRQTKFTKQEIRVMYRGFKTECPEGVVHEDCFKDIYAKFFPHGNSSLYA 81
            ||.|...| |....:|.::.:|.              |||   .|.|||:         ||.|.:
 Frog    58 EHQRSRSP-PTHGRNLRKRQQFF--------------CPE---CERCFKN---------NSELES 95

  Fly    82 H 82
            |
 Frog    96 H 96

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5890NP_001356889.1 FRQ1 29..192 CDD:227455 13/54 (24%)
znf852NP_001039058.1 C2H2 Zn finger 80..100 CDD:275368 11/29 (38%)
C2H2 Zn finger 108..128 CDD:275368
COG5048 <109..319 CDD:227381
SUF4-like 170..>222 CDD:411020
C2H2 Zn finger 172..197 CDD:411020
C2H2 Zn finger 172..192 CDD:275368
C2H2 Zn finger 200..220 CDD:411020
C2H2 Zn finger 200..220 CDD:275368
C2H2 Zn finger 228..248 CDD:275368
C2H2 Zn finger 256..272 CDD:275368
SUF4-like 280..>332 CDD:411020
C2H2 Zn finger 284..309 CDD:411020
C2H2 Zn finger 284..304 CDD:275368
C2H2 Zn finger 312..332 CDD:411020
C2H2 Zn finger 312..332 CDD:275368
C2H2 Zn finger 340..360 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165162837
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.