DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5890 and Kcnip1

DIOPT Version :9

Sequence 1:NP_001356889.1 Gene:CG5890 / 43126 FlyBaseID:FBgn0039380 Length:229 Species:Drosophila melanogaster
Sequence 2:XP_017170240.1 Gene:Kcnip1 / 70357 MGIID:1917607 Length:249 Species:Mus musculus


Alignment Length:199 Identity:100/199 - (50%)
Similarity:141/199 - (70%) Gaps:5/199 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 EEVVYELEHTRVPKPIPVALEDLCRQTKFTKQEIRVMYRGFKTECPEGVVHEDCFKDIYAKFFPH 74
            :::..|||.|.|... |..||.|..||.|||:|::|:|||||.|||.|||:|:.||.|||:||||
Mouse    50 DKIEDELEMTMVCHR-PEGLEQLEAQTNFTKRELQVLYRGFKNECPSGVVNEETFKQIYAQFFPH 113

  Fly    75 GNSSLYAHYVFKAFDVNCNGAISFRDLLVTLSTLLRGSVYERLRWTFKLYDLNGDGRISR----G 135
            |::|.||||:|.|||....|::.|.|.:..||.||||:|:|:|||||.|||:|.||.|::    .
Mouse   114 GDASTYAHYLFNAFDTTQTGSVKFEDFVTALSILLRGTVHEKLRWTFNLYDINKDGYINKEVPFQ 178

  Fly   136 ELSEIILAIHELMGRRPHQPEDDRKARDQVDRVFRKLDLNQDGIITIEEFLEACLKDDLVTRSLQ 200
            |:.:|:.||:::||:..:....:...|..||..|:|:|.|:|||:|::||||:|.:||.:.||||
Mouse   179 EMMDIVKAIYDMMGKYTYPVLKEDTPRQHVDVFFQKMDKNKDGIVTLDEFLESCQEDDNIMRSLQ 243

  Fly   201 MFDN 204
            :|.|
Mouse   244 LFQN 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5890NP_001356889.1 FRQ1 29..192 CDD:227455 86/166 (52%)
Kcnip1XP_017170240.1 FRQ1 68..238 CDD:227455 88/169 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167833425
Domainoid 1 1.000 96 1.000 Domainoid score I7294
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H22824
Inparanoid 1 1.050 212 1.000 Inparanoid score I3634
Isobase 1 0.950 - 0 Normalized mean entropy S788
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D606780at33208
OrthoFinder 1 1.000 - - FOG0000038
OrthoInspector 1 1.000 - - otm42579
orthoMCL 1 0.900 - - OOG6_101448
Panther 1 1.100 - - O PTHR23055
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5210
SonicParanoid 1 1.000 - - X31
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1312.880

Return to query results.
Submit another query.