DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5890 and Kcnip3

DIOPT Version :9

Sequence 1:NP_001356889.1 Gene:CG5890 / 43126 FlyBaseID:FBgn0039380 Length:229 Species:Drosophila melanogaster
Sequence 2:XP_017447516.1 Gene:Kcnip3 / 65199 RGDID:70888 Length:290 Species:Rattus norvegicus


Alignment Length:203 Identity:96/203 - (47%)
Similarity:140/203 - (68%) Gaps:3/203 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 ASPPESPIEEVVYELEHTRVPKPIPVALEDLCRQTKFTKQEIRVMYRGFKTECPEGVVHEDCFKD 66
            |:|..|...:...||...|..   |..|:.|..||||||:|::.:|||||.|||.|:|.||.||.
  Rat    89 AAPQGSDSSDSELELSTVRHQ---PEGLDQLQAQTKFTKKELQSLYRGFKNECPTGLVDEDTFKL 150

  Fly    67 IYAKFFPHGNSSLYAHYVFKAFDVNCNGAISFRDLLVTLSTLLRGSVYERLRWTFKLYDLNGDGR 131
            ||::|||.|:::.|||::|.|||.:.||||.|.|.:|.||.||||:|:|:|:|.|.|||:|.||.
  Rat   151 IYSQFFPQGDATTYAHFLFNAFDADGNGAIHFEDFVVGLSILLRGTVHEKLKWAFNLYDINKDGY 215

  Fly   132 ISRGELSEIILAIHELMGRRPHQPEDDRKARDQVDRVFRKLDLNQDGIITIEEFLEACLKDDLVT 196
            |::.|:..|:.:|:::|||..:....:....:.|:|.|:|:|.||||::||:||||.|.||:.:.
  Rat   216 ITKEEMLAIMKSIYDMMGRHTYPILREDAPLEHVERFFQKMDRNQDGVVTIDEFLETCQKDENIM 280

  Fly   197 RSLQMFDN 204
            .|:|:|:|
  Rat   281 SSMQLFEN 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5890NP_001356889.1 FRQ1 29..192 CDD:227455 83/162 (51%)
Kcnip3XP_017447516.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166336997
Domainoid 1 1.000 96 1.000 Domainoid score I7128
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 210 1.000 Inparanoid score I3579
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D606780at33208
OrthoFinder 1 1.000 - - FOG0000038
OrthoInspector 1 1.000 - - otm44648
orthoMCL 1 0.900 - - OOG6_101448
Panther 1 1.100 - - O PTHR23055
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X31
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1110.900

Return to query results.
Submit another query.