DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5890 and Kcnip1

DIOPT Version :9

Sequence 1:NP_001356889.1 Gene:CG5890 / 43126 FlyBaseID:FBgn0039380 Length:229 Species:Drosophila melanogaster
Sequence 2:XP_006246167.1 Gene:Kcnip1 / 65023 RGDID:70886 Length:245 Species:Rattus norvegicus


Alignment Length:195 Identity:99/195 - (50%)
Similarity:141/195 - (72%) Gaps:1/195 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 EEVVYELEHTRVPKPIPVALEDLCRQTKFTKQEIRVMYRGFKTECPEGVVHEDCFKDIYAKFFPH 74
            :::..:||.|.|... |..||.|..||.|||:|::|:|||||.|||.|||:|:.||.|||:||||
  Rat    50 DKIEDDLEMTMVCHR-PEGLEQLEAQTNFTKRELQVLYRGFKNECPSGVVNEETFKQIYAQFFPH 113

  Fly    75 GNSSLYAHYVFKAFDVNCNGAISFRDLLVTLSTLLRGSVYERLRWTFKLYDLNGDGRISRGELSE 139
            |::|.||||:|.|||....|::.|.|.:..||.||||:|:|:|||||.|||:|.||.|::.|:.:
  Rat   114 GDASTYAHYLFNAFDTTQTGSVKFEDFVTALSILLRGTVHEKLRWTFNLYDINKDGYINKEEMMD 178

  Fly   140 IILAIHELMGRRPHQPEDDRKARDQVDRVFRKLDLNQDGIITIEEFLEACLKDDLVTRSLQMFDN 204
            |:.||:::||:..:....:...|..||..|:|:|.|:|||:|::||||:|.:||.:.||||:|.|
  Rat   179 IVKAIYDMMGKYTYPVLKEDTPRQHVDVFFQKMDKNKDGIVTLDEFLESCQEDDNIMRSLQLFQN 243

  Fly   205  204
              Rat   244  243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5890NP_001356889.1 FRQ1 29..192 CDD:227455 86/162 (53%)
Kcnip1XP_006246167.1 FRQ1 68..234 CDD:227455 88/165 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166336980
Domainoid 1 1.000 96 1.000 Domainoid score I7128
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H22824
Inparanoid 1 1.050 210 1.000 Inparanoid score I3579
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D606780at33208
OrthoFinder 1 1.000 - - FOG0000038
OrthoInspector 1 1.000 - - otm44648
orthoMCL 1 0.900 - - OOG6_101448
Panther 1 1.100 - - O PTHR23055
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X31
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1110.900

Return to query results.
Submit another query.