Sequence 1: | NP_001356889.1 | Gene: | CG5890 / 43126 | FlyBaseID: | FBgn0039380 | Length: | 229 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_071380.1 | Gene: | CHP2 / 63928 | HGNCID: | 24927 | Length: | 196 | Species: | Homo sapiens |
Alignment Length: | 196 | Identity: | 42/196 - (21%) |
---|---|---|---|
Similarity: | 70/196 - (35%) | Gaps: | 77/196 - (39%) |
- Green bases have known domain annotations that are detailed below.
Fly 68 YAKFFPHGN-----------SSLYAHYVFKAFDVNCNGAISFRDL-------------------- 101
Fly 102 -----------LVTLSTLLR------------------GSVYERLRWTFKLYDLNGDGRISRGEL 137
Fly 138 SEIILAIHELMGRRPHQPEDDRKARDQVDRVFRKLDLNQDGIITIEEFLEACLKDDLVTRSLQMF 202
Fly 203 D 203 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG5890 | NP_001356889.1 | FRQ1 | 29..192 | CDD:227455 | 38/183 (21%) |
CHP2 | NP_071380.1 | FRQ1 | 16..179 | CDD:227455 | 35/179 (20%) |
Nuclear export signal | 137..148 | 1/13 (8%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |