DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5890 and Kcnip2

DIOPT Version :9

Sequence 1:NP_001356889.1 Gene:CG5890 / 43126 FlyBaseID:FBgn0039380 Length:229 Species:Drosophila melanogaster
Sequence 2:NP_064479.2 Gene:Kcnip2 / 56817 RGDID:70887 Length:270 Species:Rattus norvegicus


Alignment Length:179 Identity:87/179 - (48%)
Similarity:134/179 - (74%) Gaps:0/179 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 PVALEDLCRQTKFTKQEIRVMYRGFKTECPEGVVHEDCFKDIYAKFFPHGNSSLYAHYVFKAFDV 90
            |..||.|..|||||::|::|:|||||.|||.|:|:|:.||.||::|||.|:||.||.::|.|||.
  Rat    90 PEGLEQLQEQTKFTRRELQVLYRGFKNECPSGIVNEENFKQIYSQFFPQGDSSNYATFLFNAFDT 154

  Fly    91 NCNGAISFRDLLVTLSTLLRGSVYERLRWTFKLYDLNGDGRISRGELSEIILAIHELMGRRPHQP 155
            |.:|::||.|.:..||.:|||::.:||.|.|.|||||.||.|::.|:.:|:.:|:::||:..:..
  Rat   155 NHDGSVSFEDFVAGLSVILRGTIDDRLSWAFNLYDLNKDGCITKEEMLDIMKSIYDMMGKYTYPA 219

  Fly   156 EDDRKARDQVDRVFRKLDLNQDGIITIEEFLEACLKDDLVTRSLQMFDN 204
            ..:...|:.|:..|:|:|.|:||::|||||:|:|.:|:.:.||:|:|||
  Rat   220 LREEAPREHVESFFQKMDRNKDGVVTIEEFIESCQQDENIMRSMQLFDN 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5890NP_001356889.1 FRQ1 29..192 CDD:227455 79/162 (49%)
Kcnip2NP_064479.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..34
FRQ1 93..259 CDD:227455 80/165 (48%)
Interaction with KCND2. /evidence=ECO:0000250|UniProtKB:Q8R426 257..270 6/12 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166337001
Domainoid 1 1.000 96 1.000 Domainoid score I7128
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 210 1.000 Inparanoid score I3579
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D606780at33208
OrthoFinder 1 1.000 - - FOG0000038
OrthoInspector 1 1.000 - - otm44648
orthoMCL 1 0.900 - - OOG6_101448
Panther 1 1.100 - - O PTHR23055
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X31
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1110.900

Return to query results.
Submit another query.