DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5890 and Kcnip3

DIOPT Version :9

Sequence 1:NP_001356889.1 Gene:CG5890 / 43126 FlyBaseID:FBgn0039380 Length:229 Species:Drosophila melanogaster
Sequence 2:NP_001277934.1 Gene:Kcnip3 / 56461 MGIID:1929258 Length:284 Species:Mus musculus


Alignment Length:190 Identity:94/190 - (49%)
Similarity:138/190 - (72%) Gaps:1/190 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 ELEHTRVPKPIPVALEDLCRQTKFTKQEIRVMYRGFKTECPEGVVHEDCFKDIYAKFFPHGNSSL 79
            |||.:.| :..|..|:.|..||||||:|::.:|||||.|||.|:|.||.||.||::|||.|:::.
Mouse    94 ELELSTV-RHQPEGLDQLQAQTKFTKKELQSLYRGFKNECPTGLVDEDTFKLIYSQFFPQGDATT 157

  Fly    80 YAHYVFKAFDVNCNGAISFRDLLVTLSTLLRGSVYERLRWTFKLYDLNGDGRISRGELSEIILAI 144
            |||::|.|||.:.||||.|.|.:|.||.||||:|:|:|:|.|.|||:|.||.|::.|:..|:.:|
Mouse   158 YAHFLFNAFDADGNGAIHFEDFVVGLSILLRGTVHEKLKWAFNLYDINKDGCITKEEMLAIMKSI 222

  Fly   145 HELMGRRPHQPEDDRKARDQVDRVFRKLDLNQDGIITIEEFLEACLKDDLVTRSLQMFDN 204
            :::|||..:....:....:.|:|.|:|:|.||||::||:||||.|.||:.:..|:|:|:|
Mouse   223 YDMMGRHTYPILREDAPLEHVERFFQKMDRNQDGVVTIDEFLETCQKDENIMNSMQLFEN 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5890NP_001356889.1 FRQ1 29..192 CDD:227455 83/162 (51%)
Kcnip3NP_001277934.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 27..57
FRQ1 109..273 CDD:227455 84/163 (52%)
EFh 158..220 CDD:238008 34/61 (56%)
EFh 194..265 CDD:238008 29/70 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167833441
Domainoid 1 1.000 96 1.000 Domainoid score I7294
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 212 1.000 Inparanoid score I3634
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000038
OrthoInspector 1 1.000 - - otm42579
orthoMCL 1 0.900 - - OOG6_101448
Panther 1 1.100 - - O PTHR23055
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5210
SonicParanoid 1 1.000 - - X31
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1110.920

Return to query results.
Submit another query.