DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5890 and ppp3r1a

DIOPT Version :9

Sequence 1:NP_001356889.1 Gene:CG5890 / 43126 FlyBaseID:FBgn0039380 Length:229 Species:Drosophila melanogaster
Sequence 2:XP_009305321.1 Gene:ppp3r1a / 564337 ZFINID:ZDB-GENE-081113-3 Length:175 Species:Danio rerio


Alignment Length:174 Identity:44/174 - (25%)
Similarity:81/174 - (46%) Gaps:24/174 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 EHTRVPKPIPVALEDLCRQT--KFTKQEIRVMYRGFKTECPE--GVVHEDCFKDIYAKFFPHGNS 77
            :::.:.||       ||..|  :|...||:.:.:.||....:  |.:..:.|..:     |....
Zfish     4 KYSTMGKP-------LCGMTSVRFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSL-----PELQQ 56

  Fly    78 SLYAHYVFKAFDVNCNGAISFRDLLVTLSTL-LRGSVYERLRWTFKLYDLNGDGRISRGELSEII 141
            :.....|...||.:.||.:.|::.:..:|.. ::|....:||:.|::||::.||.||.|||.:: 
Zfish    57 NPLVQRVIDIFDTDGNGEVDFKEFIEGVSQFSVKGDKEMKLRFAFRIYDMDKDGYISNGELFQV- 120

  Fly   142 LAIHELMGRRPHQPEDDRKARDQVDRVFRKLDLNQDGIITIEEF 185
              :..::|..    ..|.:.:..||:.....|.:.||.|:.|||
Zfish   121 --LKMMVGNN----LKDTQLQQIVDKTIINADKDGDGRISFEEF 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5890NP_001356889.1 FRQ1 29..192 CDD:227455 42/162 (26%)
ppp3r1aXP_009305321.1 FRQ1 14..162 CDD:227455 40/157 (25%)
EFh 30..85 CDD:238008 11/59 (19%)
EFh 96..162 CDD:238008 23/70 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.