DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5890 and si:ch211-245j22.3

DIOPT Version :9

Sequence 1:NP_001356889.1 Gene:CG5890 / 43126 FlyBaseID:FBgn0039380 Length:229 Species:Drosophila melanogaster
Sequence 2:NP_001074270.1 Gene:si:ch211-245j22.3 / 563798 ZFINID:ZDB-GENE-050419-38 Length:194 Species:Danio rerio


Alignment Length:178 Identity:58/178 - (32%)
Similarity:97/178 - (54%) Gaps:12/178 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 CRQTKFTKQEIRVMYRGFKTECPEGVV--HEDCFKDIYAKFFPHG----NSSLYAHYVFKAFDVN 91
            ||:......|:...:|.|..|||.|::  ||      :.:.|.:|    .|:.||..:|:..|.|
Zfish     9 CRKGGTYVIELYEWFRKFLNECPSGLITLHE------FRRHFCNGTVGKESAEYAEQIFRTLDNN 67

  Fly    92 CNGAISFRDLLVTLSTLLRGSVYERLRWTFKLYDLNGDGRISRGELSEIILAIHELMGRRPHQPE 156
            .:|.:.||:.:..:|.|:.||..|:|||:|||||.:.||.|:|.|:.||:.|::::.........
Zfish    68 GDGVVDFREYVTAISMLIEGSTVEKLRWSFKLYDKDKDGAITRSEMLEIMQAVYKMSVAASLTKP 132

  Fly   157 DDRKARDQVDRVFRKLDLNQDGIITIEEFLEACLKDDLVTRSLQMFDN 204
            |...|.:..:|:|.:||.:.:.||:.:||:|..|.|:.:...|:...|
Zfish   133 DPLTAEECTNRIFVRLDKDNNAIISQDEFIEGALNDEWIREMLECDPN 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5890NP_001356889.1 FRQ1 29..192 CDD:227455 55/164 (34%)
si:ch211-245j22.3NP_001074270.1 EF-hand_8 31..78 CDD:290545 15/52 (29%)
EF-hand_7 32..81 CDD:290234 14/54 (26%)
EFh 56..118 CDD:238008 28/61 (46%)
EF-hand_7 57..117 CDD:290234 26/59 (44%)
EFh 92..164 CDD:238008 26/71 (37%)
EF-hand_7 93..163 CDD:290234 26/69 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170576135
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000038
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X31
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.