DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5890 and efcab1

DIOPT Version :9

Sequence 1:NP_001356889.1 Gene:CG5890 / 43126 FlyBaseID:FBgn0039380 Length:229 Species:Drosophila melanogaster
Sequence 2:NP_001038325.1 Gene:efcab1 / 558421 ZFINID:ZDB-GENE-040914-40 Length:216 Species:Danio rerio


Alignment Length:184 Identity:53/184 - (28%)
Similarity:95/184 - (51%) Gaps:13/184 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 EDLCRQTK-FTKQEIRVMYRGFKTECPEGVVHEDCFKDIYAKF---FPHG---NSSLYAHYVFKA 87
            |.||||.| |.|.|...:.|.|.:...|....:.......|||   ..|.   ...:....|.:.
Zfish    17 ETLCRQVKHFNKTETECLIRLFNSLLGEQAERKTTIGVDRAKFRNILHHTFGMTDDMMTDRVCRV 81

  Fly    88 FDVNCNGAISFRDLLVTLSTLLRGSVYERLRWTFKLYDLNGDGRISRGELSEIILAIHELMGRRP 152
            .|.:.:|.:|.::.:..||..|||::.|::::.|::|||||||.|||.|:.::   :.:.:.|:|
Zfish    82 IDKDNDGYLSVKEWVEALSVFLRGTLDEKMKYCFEVYDLNGDGYISREEMFQM---LKDSLIRQP 143

  Fly   153 HQPEDDRKARDQVDRVFRKLDLNQDGIITIEEFLEACLKDDLVTRSLQMFDNDL 206
            .:.:.|...:|.|:...:|:|.:.||.::..:|.:..:.::|:   |:.|.|.|
Zfish   144 TEEDPDEGIKDIVEIALKKMDYDHDGRVSYADFEKTVMDENLL---LEAFGNCL 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5890NP_001356889.1 FRQ1 29..192 CDD:227455 48/168 (29%)
efcab1NP_001038325.1 EFh 80..136 CDD:238008 21/58 (36%)
EF-hand_7 80..135 CDD:290234 21/57 (37%)
EFh 110..176 CDD:238008 21/68 (31%)
EF-hand_7 111..178 CDD:290234 22/69 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170576131
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X31
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.