DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5890 and PPP3R2

DIOPT Version :9

Sequence 1:NP_001356889.1 Gene:CG5890 / 43126 FlyBaseID:FBgn0039380 Length:229 Species:Drosophila melanogaster
Sequence 2:NP_671709.2 Gene:PPP3R2 / 5535 HGNCID:9318 Length:170 Species:Homo sapiens


Alignment Length:165 Identity:43/165 - (26%)
Similarity:79/165 - (47%) Gaps:18/165 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 DLCRQTKFTKQEIRVMYRGFK--TECPEGVVHEDCFKDIYAKFFPHGNSSLYAHYVFKAFDVNCN 93
            ::|  :.|...||:.:.|.||  .....|.:..:.|..:     |....:.....|...||.:.:
Human    10 EMC--SHFDNDEIKRLGRRFKKLDLDKSGSLSVEEFMSL-----PELRHNPLVRRVIDVFDTDGD 67

  Fly    94 GAISFRDLLVTLSTL-LRGSVYERLRWTFKLYDLNGDGRISRGELSEIILAIHELMGRRPHQPED 157
            |.:.|::.::..|.. ::|...::||:.|.:||::.||.||.|||.::   :..::|..    ..
Human    68 GEVDFKEFILGTSQFSVKGDEEQKLRFAFSIYDMDKDGYISNGELFQV---LKMMVGNN----LT 125

  Fly   158 DRKARDQVDRVFRKLDLNQDGIITIEEFLEACLKD 192
            |.:.:..||:....||.:.||.|:.||| .|.::|
Human   126 DWQLQQLVDKTIIILDKDGDGKISFEEF-SAVVRD 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5890NP_001356889.1 FRQ1 29..192 CDD:227455 42/163 (26%)
PPP3R2NP_671709.2 FRQ1 13..159 CDD:227455 41/158 (26%)
Calcineurin A binding. /evidence=ECO:0000250|UniProtKB:P63098 131..136 2/4 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.