DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5890 and efcab1

DIOPT Version :9

Sequence 1:NP_001356889.1 Gene:CG5890 / 43126 FlyBaseID:FBgn0039380 Length:229 Species:Drosophila melanogaster
Sequence 2:NP_001016778.1 Gene:efcab1 / 549532 XenbaseID:XB-GENE-5727529 Length:208 Species:Xenopus tropicalis


Alignment Length:205 Identity:53/205 - (25%)
Similarity:102/205 - (49%) Gaps:27/205 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 ALEDLCRQTKFTKQEIRVMYRGFKTECPEGV-------VHEDCFKDIYAKFFPHGNSSLYAHYVF 85
            ||..|.:.  |:|.|:..:.|.:.|.....:       :..:.|::|....|.. ...:....||
 Frog    12 ALSRLIKH--FSKNEVESLIRLYHTLVGRPIDPNTRRGIDRNTFRNILHNTFGM-TDDMIMDRVF 73

  Fly    86 KAFDVNCNGAISFRDLLVTLSTLLRGSVYERLRWTFKLYDLNGDGRISRGELSEIILAIHELMGR 150
            :.||.:.:..||..:.:..||..|||::.||:::.|.:|||||||.|||.|:..::.  :.|: :
 Frog    74 RGFDKDNDSYISVTEWVEGLSVFLRGTLEERIKYCFGVYDLNGDGYISREEMFHMLK--NSLL-K 135

  Fly   151 RPHQPEDDRKARDQVDRVFRKLDLNQDGIITIEEFLEACLKDDLVTRSLQMFDNDLXXQEGELEP 215
            :|.:.:.|...:|.|:...:|:|.:.|..::..:|.:|..:::|:   |:.|.           |
 Frog   136 QPSEEDPDEGVKDLVEIALKKMDYDHDSKLSYMDFEKAVQEENLL---LEAFG-----------P 186

  Fly   216 GLRNSRTIIS 225
            .|.:|:.|::
 Frog   187 CLPDSKCIMA 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5890NP_001356889.1 FRQ1 29..192 CDD:227455 45/169 (27%)
efcab1NP_001016778.1 EF-hand_7 69..129 CDD:290234 25/59 (42%)
EFh 71..130 CDD:238008 25/58 (43%)
EFh 104..175 CDD:238008 23/73 (32%)
EF-hand_7 105..174 CDD:290234 21/71 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X31
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.