DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5890 and cib1

DIOPT Version :9

Sequence 1:NP_001356889.1 Gene:CG5890 / 43126 FlyBaseID:FBgn0039380 Length:229 Species:Drosophila melanogaster
Sequence 2:NP_001011480.1 Gene:cib1 / 496971 XenbaseID:XB-GENE-970951 Length:190 Species:Xenopus tropicalis


Alignment Length:174 Identity:39/174 - (22%)
Similarity:79/174 - (45%) Gaps:25/174 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 TKFTKQEIRVMYRGFKTECPEGVVHEDCFKDIYA------KF--FPHGNSSLYAHYVFKAFDVN- 91
            |..|||||.:.|:.|..     |..:|...:|.:      :|  .|...::.:...:...|..: 
 Frog    20 TYLTKQEIILAYKRFSE-----VAQKDNRSNIESLRIPKERFLNLPELKANPFNDRICTVFSTSE 79

  Fly    92 -CNGAISFRDLLVTLSTLLRGSVYE-RLRWTFKLYDLNGDGRISRGELSEIILAIHELMGRRPHQ 154
             .:|::||.|.|..||.....:..| :..:.|:::|.:|||.::..:|..:   :::|.|.:...
 Frog    80 QEDGSMSFEDFLDMLSAFSESATLEVKSHYAFRIFDFDGDGALNESDLEHL---VNKLTGDKDDT 141

  Fly   155 PEDDRKARDQVDRVFRKLDLNQDGIITIEEFLEACLKDDLVTRS 198
            ...:.:.|..:..:..:.|:::||.|...||      ..:::||
 Frog   142 KLSNSEMRQLIANILEESDIDKDGTINHSEF------QHVISRS 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5890NP_001356889.1 FRQ1 29..192 CDD:227455 37/166 (22%)
cib1NP_001011480.1 FRQ1 20..181 CDD:227455 39/174 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X31
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.