DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5890 and guca1d

DIOPT Version :9

Sequence 1:NP_001356889.1 Gene:CG5890 / 43126 FlyBaseID:FBgn0039380 Length:229 Species:Drosophila melanogaster
Sequence 2:NP_001011661.1 Gene:guca1d / 494573 ZFINID:ZDB-GENE-040724-231 Length:185 Species:Danio rerio


Alignment Length:160 Identity:48/160 - (30%)
Similarity:87/160 - (54%) Gaps:12/160 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 ALEDLCRQTKFTKQEIRVMYRGFKTECPEGVVHEDCFKDIYAKFFPHGNSSLYAHYVFKAFDVNC 92
            :|:|:      ..:::...|..|..|.|.|::.....|.|......:.:::.|...||..||::.
Zfish     7 SLDDI------LAEDMHHWYNKFMRESPSGLITLFELKSILGLQGMNEDANSYVDQVFCTFDMDR 65

  Fly    93 NGAISFRDLLVTLSTLLRGSVYERLRWTFKLYDLNGDGRISRGELSEIILAIHELMGRRPHQPED 157
            :|.|.|.:.:..:|.:|:|.:.::|:|.|||:|.:|:|:|.:.||..|..||.::...|...|| 
Zfish    66 DGYIDFVEYIAAISLMLKGEINQKLKWYFKLFDQDGNGKIDKDELETIFTAIQDITRNRDIVPE- 129

  Fly   158 DRKARDQVDRVFRKLDLNQDGIITIEEFLE 187
                 :.|..:|.|:|:|.:|.:|:|||:|
Zfish   130 -----EIVALIFEKIDVNGEGELTLEEFIE 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5890NP_001356889.1 FRQ1 29..192 CDD:227455 48/159 (30%)
guca1dNP_001011661.1 EF-hand_8 28..76 CDD:290545 12/47 (26%)
EFh 53..110 CDD:238008 20/56 (36%)
EF-hand_7 56..114 CDD:290234 21/57 (37%)
EFh 89..157 CDD:238008 28/72 (39%)
EF-hand_7 90..154 CDD:290234 27/69 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170576137
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X31
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.